KEGG   Burkholderia cenocepacia AU1054: Bcen_0520Help
Entry
Bcen_0520         CDS       T00363                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
bcn  Burkholderia cenocepacia AU1054
Pathway
bcn00230  Purine metabolism
bcn01100  Metabolic pathways
Module
bcn_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:bcn00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Bcen_0520
Enzymes [BR:bcn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Bcen_0520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 MMR_HSR1 AAA_18 RsgA_GTPase ABC_tran AAA_16 AAA_22 AAA_29 Septin AAA_23 DUF3987 AAA_25 Viral_helicase1 cobW Dynamin_N
Motif
Other DBs
NCBI-ProteinID: ABF75432
UniProt: Q1BY73
Position
1:561100..561783
Genome map
AA seq 227 aa AA seqDB search
MTDSTRDGHASHSLHGGVYPGNLFMVVAPSGAGKSTLVNALLSKDSDICLSISYTTRKPR
PGEQDGQHYHFTTVEDFRARHAAHEFLESAEVHGNYYGTSRVWIEEQMRNGHDVLLEIDW
QGALQVKKQFRNAVGIFILPPSLDALEERLKKRGQDEPNVITRRLLAAGSEIAHASEAEY
VVINENFERALAELECIVAATRLRFASQYARHTELFIDLGVHLPHAE
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgaccgattccacccgcgacggccacgcgtcgcattcgctgcatggcggcgtctatccc
ggtaacctgttcatggtcgtcgcgccgtcgggcgccggcaagtcgacgctcgtgaatgcg
ctgctgtcgaaggacagcgacatctgcctgtcgatctcgtacacgacgcgcaagccgcgc
ccgggcgagcaggacggccagcactaccacttcacgaccgtcgaggatttccgcgcacgt
cacgcggcgcacgaattcctcgagagcgcggaagtgcacggcaactactacggcacgtcg
cgcgtctggatcgaagagcagatgaggaacggccacgacgtgctgctcgaaatcgactgg
cagggtgcgttgcaggtgaagaagcagttccgcaacgcggtcggcatcttcatcctgccg
ccgtcgctcgatgcgctcgaagagcgcctgaagaagcgcggccaggacgaaccgaacgtg
atcacgcggcgcctgctggccgccggcagcgagatcgcgcacgcgtcggaagcggaatac
gtggtgatcaacgagaatttcgagcgtgcgctcgcggaactcgaatgcatcgtcgcggcg
acgcgcctgcgttttgcttcgcagtacgcgcgacacacggagctgttcatcgacctcggc
gtccatctgccccacgcggaatga

DBGET integrated database retrieval system