KEGG   Burkholderia cenocepacia AU1054: Bcen_0603Help
Entry
Bcen_0603         CDS       T00363                                 

Definition
(GenBank) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
bcn  Burkholderia cenocepacia AU1054
Pathway
bcn00670  One carbon pool by folate
bcn00790  Folate biosynthesis
bcn01100  Metabolic pathways
Module
bcn_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bcn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Bcen_0603
   00670 One carbon pool by folate
    Bcen_0603
Enzymes [BR:bcn01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Bcen_0603
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1 peroxidase
Motif
Other DBs
NCBI-ProteinID: ABF75514
UniProt: A0A0H2XM17
Position
1:complement(649319..649879)
Genome map
AA seq 186 aa AA seqDB search
MRATVPVKSAPFRFPSSPTFMTTLTLIVARARNGIIGRDNQLPWKLPEDLAFFKRTTMGA
PIVMGRKTHESIGRPLPGRRNIVVTRDATRRFEGCDTVTSLADALALAARDGVPEAFLIG
GAQLYAEGLMLADKLIVTEIDADFDGGASFPAPDAAHWQEVSRDAHQAAAPNTFGYAFVV
YTRKRD
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgccaccgttccggtaaaatcggccccattccgtttcccctcttccccgaccttc
atgacgacgttgaccctgatcgtcgcgcgtgcccgcaacggcatcatcggccgcgacaac
cagttgccctggaaacttcccgaggatctcgcgttcttcaagcgcacgacgatgggcgcg
ccgatcgtgatgggccgcaagacccacgagtcgatcggccggccgctgccgggccgccgc
aacatcgtcgtcacgcgcgacgccacgcgccgtttcgaaggctgcgacacggtcacgtcg
ctcgccgatgcgctggcgctcgccgcgcgcgacggggtgcccgaggcattcctgatcggc
ggtgcacaactctatgcggaaggtctcatgctcgccgacaagctgatcgtcaccgagatc
gacgccgacttcgacggcggcgcatcgttcccggcgcccgatgccgcacactggcaggaa
gtctcgcgcgacgcgcatcaggctgccgcgcccaacacgttcggctatgcgttcgtcgtc
tacacgcgcaagcgcgactga

DBGET integrated database retrieval system