KEGG   Burkholderia cenocepacia AU1054: Bcen_0983Help
Entry
Bcen_0983         CDS       T00363                                 

Definition
(GenBank) 3-oxoacid CoA-transferase, subunit A
  KO
K01028  3-oxoacid CoA-transferase subunit A [EC:2.8.3.5]
Organism
bcn  Burkholderia cenocepacia AU1054
Pathway
bcn00072  Synthesis and degradation of ketone bodies
bcn00280  Valine, leucine and isoleucine degradation
bcn00650  Butanoate metabolism
bcn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Bcen_0983
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Bcen_0983
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Bcen_0983
Enzymes [BR:bcn01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     Bcen_0983
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans Mal_decarbox_Al
Motif
Other DBs
NCBI-ProteinID: ABF75892
UniProt: A0A0H2XMH1
Position
1:1075175..1075879
Genome map
AA seq 234 aa AA seqDB search
MNKVYPSAAAALEGIVRDGQTFAVGGFGLCGIPEALIAALRDSAVKGITCISNNAGVDGF
GLGLLLETRQIKKMISSYVGENKEFERQYLAGELELEFTPQGTLAEKLRAGGAGIPAFFT
NTGYGTVIAEGKETRQFGDRHYVLEPSLTADVALVKAWKADKSGNLIYRRTARNFNPMCA
MAGKITVVEVEEIVENGTLDPDQVHTPGIFVQRIVLNATPEKRIEQRVVRAKGD
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaagtctatccaagcgcggctgccgcgctggaggggatcgtccgtgacggacag
accttcgcggtgggcggcttcggcctgtgcgggattcccgaggcgctgatcgcggcgttg
cgcgattcggccgtcaagggcatcacctgcatcagcaacaatgcgggcgtcgacggtttc
ggcctcggcctgctgctggaaacgcgccagatcaagaagatgatctcgtcgtacgtcggc
gagaacaaggagttcgagcgccagtacctggccggcgaactcgagctcgaattcacgccg
cagggcacgctcgccgaaaagctgcgcgcgggcggcgcgggcatccccgcgttcttcacg
aataccggctacggcacagtgatcgcggaaggcaaggaaacgcgccagttcggcgatcgc
cactacgtgctcgagccgtcgctgacggccgacgtcgcgctcgtcaaggcgtggaaggcc
gacaagtccggcaacctgatctatcgccgcaccgcgcgcaacttcaacccgatgtgcgcg
atggccggcaagatcaccgtggtcgaagtcgaggagatcgtcgagaacggtacgctcgat
ccggatcaggtccatacgccggggatcttcgtgcagcgcatcgtgctgaacgcgacgccc
gaaaaacgcatcgaacaacgcgtcgtacgcgcgaaaggagactga

DBGET integrated database retrieval system