KEGG   Burkholderia cenocepacia AU1054: Bcen_1553Help
Entry
Bcen_1553         CDS       T00363                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bcn  Burkholderia cenocepacia AU1054
Pathway
bcn00071  Fatty acid degradation
bcn00072  Synthesis and degradation of ketone bodies
bcn00280  Valine, leucine and isoleucine degradation
bcn00310  Lysine degradation
bcn00362  Benzoate degradation
bcn00380  Tryptophan metabolism
bcn00620  Pyruvate metabolism
bcn00630  Glyoxylate and dicarboxylate metabolism
bcn00640  Propanoate metabolism
bcn00650  Butanoate metabolism
bcn00900  Terpenoid backbone biosynthesis
bcn01100  Metabolic pathways
bcn01110  Biosynthesis of secondary metabolites
bcn01120  Microbial metabolism in diverse environments
bcn01130  Biosynthesis of antibiotics
bcn01200  Carbon metabolism
bcn01212  Fatty acid metabolism
bcn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bcn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bcen_1553
   00630 Glyoxylate and dicarboxylate metabolism
    Bcen_1553
   00640 Propanoate metabolism
    Bcen_1553
   00650 Butanoate metabolism
    Bcen_1553
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Bcen_1553
   00072 Synthesis and degradation of ketone bodies
    Bcen_1553
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Bcen_1553
   00310 Lysine degradation
    Bcen_1553
   00380 Tryptophan metabolism
    Bcen_1553
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Bcen_1553
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bcen_1553
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Bcen_1553
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bcn04147]
    Bcen_1553
Enzymes [BR:bcn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Bcen_1553
Exosome [BR:bcn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Bcen_1553
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Alk_phosphatase
Motif
Other DBs
NCBI-ProteinID: ABF76458
UniProt: A0A0H2XR57
Position
1:complement(1724810..1726003)
Genome map
AA seq 397 aa AA seqDB search
MSNAAKEVVVVSGVRTAIGDFGGSLKDFSPTDLGAKVVAEVLSRANVPGDAVGHVVFGHV
VNTEPKDMYLARVAAINGGVAQHTPALTVNRLCGSGLQAIVSAAQTIMLGDADVAIGGGS
ESMSRAPYTVPAARFGQRMGDGKLVDMMLGALHDPFQTIHMGVTAENVAKKYDISRDAQD
ALALESHRRAARAIAEGRFKDQILPISIRTKKGEVAFDTDEHVRHDASADDFTKLKPVFA
KENGTVTAGNASGINDAAAAVLMMSADAARAQGVKPLARLVAYAHAGVDPAYMGIGPVPA
TQKALERAGLKISDLDVIEANEAFAAQACAVTQELGLDPAKVNPNGSGISLGHPIGATGA
LITVKALYELKRIGGRYALVTMCIGGGQGIAAIFENI
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatgcagcgaaggaagtcgtggtggtgagcggggtccgtaccgcgatcggtgat
ttcggcggcagcctgaaggatttctcgccgaccgacctcggcgcgaaggtggtcgccgaa
gtgctgtcgcgcgcgaacgtgccgggcgacgcggtcgggcacgtcgtgttcggccacgtc
gtgaacaccgagccgaaggacatgtatctcgcgcgtgtcgcggcgatcaacggcggcgtc
gcgcagcacacgccggcgctgaccgtgaaccgcctgtgcggctcgggcctgcaggcgatc
gtatcggccgcgcagacgatcatgctcggcgatgccgacgtcgcgatcggcggcggctcg
gagagcatgagccgcgcgccgtacaccgtgccggccgcgcgcttcggccagcgcatgggc
gacggcaagctcgtcgacatgatgctcggcgcgctgcacgacccgttccagacgatccac
atgggcgtgaccgccgagaacgtcgcgaagaaatacgacatctcgcgtgacgcgcaggat
gcgctggcgctcgaatcgcatcgtcgcgcggcgcgcgcgatcgcggaagggcgtttcaag
gaccagatcctgccgatctcgatccgcacgaagaagggcgaagtggcgttcgataccgac
gagcacgtgcgccacgacgcgagcgcggacgatttcacgaagctcaagccggtgttcgcg
aaggagaacggcaccgtgacggccggcaacgcgtcgggcatcaacgacgcggccgccgcc
gtgctgatgatgagcgcggacgccgcacgcgcgcagggcgtgaagccgctcgcccgcctc
gtcgcgtatgcgcacgcaggcgtcgatccggcgtacatgggcatcggcccggtgccggcc
acgcagaaggcgctcgaacgcgcgggcctgaagatcagcgatctcgacgtgatcgaagcc
aacgaggcattcgcggcccaggcgtgtgcggtcacgcaggagctcggcctcgatccggcc
aaggtcaacccgaacggctcgggcatctcgctcggtcacccgatcggtgcgaccggcgcg
ctgatcacggtgaaggcgctgtacgagctgaagcgcatcggcgggcgttacgcgctcgtg
acgatgtgcatcggcggcggccaggggattgcggcgatcttcgagaacatctga

DBGET integrated database retrieval system