KEGG   Burkholderia cenocepacia AU 1054: Bcen_1768
Entry
Bcen_1768         CDS       T00363                                 

Definition
(GenBank) O-methyltransferase, family 3
Organism
bcn  Burkholderia cenocepacia AU 1054
SSDB
Motif
Pfam: Methyltransf_24 Methyltransf_3 Methyltransf_25 Methyltransf_11 Methyltransf_31 Methyltransf_16 CmcI DUF938 Ubie_methyltran PCMT
Other DBs
NCBI-ProteinID: ABF76671
UniProt: A0A0H2XRM3
Position
1:complement(1960758..1961534)
AA seq 258 aa
MADSGRWKRRLRDQSRQGMHLVSTTHALLQRLHEESQREIIARARAQFQGPNEAFPTLVD
EYEALAPRLRGRFLETFGLFTEDFESSAGSALSLAVSAETGRFLRNMVLAQRPTRILELG
SSCGVSTLYFADALRTLGRGVVIATECDALKCARLRAHVEAAGLDAYVDLREGDVFETVA
ALDGTVDMVFIDVWADAYLKLFKQIERLLRPGSVVLADNMYTAEDAVRPYKRYLNEDPRF
STTTLDFESGVEFTVVVA
NT seq 777 nt   +upstreamnt  +downstreamnt
atggcggatagcggtcgctggaaacgccgtctacgtgatcaatctcgtcaaggaatgcac
ttggtttctaccacccacgctcttttgcaacggcttcatgaagagagccagcgcgaaatc
atcgcccgcgcacgcgcgcagtttcaggggccgaacgaggcgtttccgacgctcgtcgac
gaatacgaagcactcgctccgaggttgcgagggcggtttctcgaaacgttcggcttgttc
accgaagatttcgagtcatcggcaggcagtgctttatcgttggccgtatcggcggaaacg
ggaaggttcttgcgcaacatggtgctcgcgcaacggccgaccagaatcctcgaactcggc
agttcgtgcggcgtgtcgactttgtatttcgccgacgcgttgcgcacgctgggccgtggc
gtggtcatcgcgaccgaatgcgatgcgctcaagtgcgcgcgtttgcgggctcatgtcgaa
gctgcgggtctggatgcctatgtcgacttgagggaaggcgatgtgttcgagacggttgcc
gcgctggatgggaccgtcgacatggtgtttatcgatgtctgggccgacgcctatctgaag
ctgttcaagcagatcgagcgcttgctgcggccgggatcggtcgtgctggctgacaacatg
tacacggccgaggacgccgttcgaccttacaagcgctacctcaacgaggatccgcggttt
tcgaccacgacgctggattttgagtcgggggttgagtttacggttgtcgtggcttga

DBGET integrated database retrieval system