KEGG   Burkholderia cenocepacia AU1054: Bcen_1840Help
Entry
Bcen_1840         CDS       T00363                                 

Definition
(GenBank) Phosphoglycerate mutase
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
bcn  Burkholderia cenocepacia AU1054
Pathway
bcn00860  Porphyrin and chlorophyll metabolism
bcn01100  Metabolic pathways
Module
bcn_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:bcn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Bcen_1840
Enzymes [BR:bcn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     Bcen_1840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ABF76743
UniProt: A0A0H2XQJ7
Position
1:complement(2039409..2039993)
Genome map
AA seq 194 aa AA seqDB search
MDIVLIRHPAVGIEPGVCYGRSDVPLADSTDGGAQAVRAHLAELGAPLPEQVWTSPLTRC
ASIAERLARAFDVPLRRDADWQEMDFGAWEMQRWDDIDRAALDAWAADLMHACAHGGESV
ARFVARVARRADALAAFDGPQWVVTHAGVIRAFASHVLRVPLDTLLSRPVPTGGVVWLRT
DDDTRTWEVVHWDA
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggacatcgtcctgatccgccatccggccgtcggcatcgagccgggcgtctgctacggg
cgcagcgacgtgccgctcgccgattcgaccgatggcggtgcgcaggccgtgcgtgcgcat
ctggcggaactcggtgcgccgttacccgagcaggtctggacgagcccgctgacgcgctgc
gcatcgattgccgaacggctcgcgcgggctttcgacgtgccgttgcggcgcgatgccgac
tggcaggaaatggatttcggtgcgtgggaaatgcagcgctgggacgatatcgaccgcgcg
gcgctcgatgcatgggcggccgacctgatgcatgcgtgcgcgcacggcggagaaagcgtc
gcgcgattcgtcgcgcgggttgcgcggcgggccgatgcgcttgcggcattcgacgggccg
caatgggtcgtcacgcatgcgggcgtgatccgcgcattcgcgtcgcatgtgttgcgcgtg
ccgctcgatacgctgctgtcgcggccggtgccgaccggcggggtcgtgtggctgcgcacg
gacgacgacacgcgcacatgggaagtcgtgcactgggacgcatag

DBGET integrated database retrieval system