KEGG   Burkholderia cenocepacia AU1054: Bcen_2563Help
Entry
Bcen_2563         CDS       T00363                                 

Definition
(GenBank) Beta-ketoadipyl CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bcn  Burkholderia cenocepacia AU1054
Pathway
bcn00071  Fatty acid degradation
bcn00072  Synthesis and degradation of ketone bodies
bcn00280  Valine, leucine and isoleucine degradation
bcn00310  Lysine degradation
bcn00362  Benzoate degradation
bcn00380  Tryptophan metabolism
bcn00620  Pyruvate metabolism
bcn00630  Glyoxylate and dicarboxylate metabolism
bcn00640  Propanoate metabolism
bcn00650  Butanoate metabolism
bcn00900  Terpenoid backbone biosynthesis
bcn01100  Metabolic pathways
bcn01110  Biosynthesis of secondary metabolites
bcn01120  Microbial metabolism in diverse environments
bcn01130  Biosynthesis of antibiotics
bcn01200  Carbon metabolism
bcn01212  Fatty acid metabolism
bcn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bcn00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bcen_2563
   00630 Glyoxylate and dicarboxylate metabolism
    Bcen_2563
   00640 Propanoate metabolism
    Bcen_2563
   00650 Butanoate metabolism
    Bcen_2563
  Lipid metabolism
   00071 Fatty acid degradation
    Bcen_2563
   00072 Synthesis and degradation of ketone bodies
    Bcen_2563
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Bcen_2563
   00310 Lysine degradation
    Bcen_2563
   00380 Tryptophan metabolism
    Bcen_2563
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Bcen_2563
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bcen_2563
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Bcen_2563
Enzymes [BR:bcn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Bcen_2563
Exosome [BR:bcn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Bcen_2563
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Phage_lysis
Motif
Other DBs
NCBI-ProteinID: ABF77462
UniProt: A0A0H2XSG0
Position
1:2820667..2821869
Genome map
AA seq 400 aa AA seqDB search
MTDAYICDAIRTPIGRYGGALKDVRADDLGAVPLKALIERNRDVDWAAIDDVIYGCANQA
GEDNRNVARMSALLAGLPTAVPGTTLNRLCGSGMDAVGTAARAIKAGEARLMIAGGVESM
TRAPFVMGKAASAFARQADIYDTTIGWRFVNPLMKQLYGVDSMPETAENVAVDYDISRAD
QDLFALRSQQKAARAQQDGTLAEEIVAVTIPQKKGDAIVVSRDEHPRETSLEALAKLKGV
VRPDGSVTAGNASGVNDGACALLLANAQAADQYGLRRRARVVGMATAGVEPRVMGIGPAP
ATQKLLRQLDMRIDQFDVIELNEAFASQGLAVLRMLGVADDDPRVNPNGGAIALGHPLGA
SGARLVTTALHQLERTGGRFALCTMCIGVGQGIAIAIERV
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgacagacgcctacatctgcgatgcgattcgcacccccatcggccgctacggcggcgcc
ctgaaagatgttcgtgccgacgacctcggcgcagtgccgctcaaggcgctgatcgagcgc
aatcgcgacgtcgactgggcggcgatcgacgacgtgatctacggctgcgcgaatcaggcc
ggcgaggacaaccgcaacgtcgcgcgcatgtcggcgctgctggcgggcctgcctactgcc
gtgccgggcacgacgctgaaccggctgtgcggttccgggatggacgcggtcggcacggcc
gcgcgcgcgatcaaggcaggtgaagcgcgcctgatgattgcaggcggcgtcgagagcatg
acgcgcgcgccgttcgtgatgggcaaggccgcaagcgcgttcgcgcgccaggccgacatc
tacgacacgacgatcggctggcgcttcgtcaatccgctgatgaagcagctgtacggtgtc
gattcgatgccggaaaccgccgagaacgtcgcggtcgactacgacatcagccgcgcggat
caggacctgttcgcgctgcgcagccagcagaaggccgcgcgggcgcagcaggacggcacg
ctcgctgaagaaatcgtcgcggtcacgattccgcagaagaaaggcgatgccatcgttgtg
tcgcgcgacgaacatccgcgcgaaacgtcgctcgaagcgctcgcgaaactgaagggcgtc
gtgcgcccggacggctcggtcacggccggcaacgcgtcgggcgtgaacgacggcgcctgc
gcgctgctgctcgccaatgcgcaggctgccgaccagtatggcctgcgccgccgcgcgcgc
gtcgtcggcatggcgaccgccggcgtcgagccgcgcgtgatgggcatcggccccgcgccg
gccacgcagaaactgctgcgccagctcgacatgcgcatcgaccagttcgacgtgatcgaa
ctgaacgaggcattcgcgtcgcaaggtctcgccgtgctgcgcatgctcggcgtggccgac
gatgatccgcgcgtgaacccgaatggcggtgcgatcgcgctgggccacccgctcggcgca
tcgggcgcgcggctcgtcaccacggcactccatcaactcgagcgtaccggcggccgcttc
gcgctctgtacgatgtgcatcggcgtcggccagggcatcgcgatcgcgatcgaacgcgtg
taa

DBGET integrated database retrieval system