KEGG   Burkholderia cenocepacia AU1054: Bcen_2630
Entry
Bcen_2630         CDS       T00363                                 

Definition
(GenBank) Rhs element Vgr protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
bcn  Burkholderia cenocepacia AU1054
Pathway
bcn03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bcn00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Bcen_2630
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bcn02044]
    Bcen_2630
Secretion system [BR:bcn02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Bcen_2630
SSDB
Motif
Pfam: Phage_GPD T6SS_Vgr Phage_base_V
Other DBs
NCBI-ProteinID: ABF77528
UniProt: A0A0H2XSA9
Position
1:complement(2893904..2896447)
AA seq 847 aa
MNVTELAQAIRGGLIQQDRLLKTDIPSLPNNALVPRRAVTRSELGRDFSVTLDLVSTASD
VELKTLVAQPITLWIQQADRSYQPINGYIHTARRLGADGGLSSYQLRFASWMHFLKFRSD
MRYWQDQPVDAILADVFDRHPQARGQYRFALSKPLPSRSYCRQSETDWNFVHRLMEDEGL
FGFWRHSEDGKAHTFVITDDLHTVDALSPNTVRFDRSGSGAETAGFTQWTASRTLQSTLH
TTRTFDYKSPSSAGNPNGTSLPTKSGQGELPDQAEIYEYTGAYTYPAQDRGEHLSKIRLE
EWESRAKRFFGVGGVRSIDAGRRFTLVDHPEHDRDAASDREFAAIGVTRYIENNLPASDH
EASFPHSLQDALAQVKAGHGKGGAFEVGHDDGSAGFYLVEVEAQRASMPYRSPFEHRKPA
MQLETAVVVGPKGEEVYTDALNRIKVMFVWDRQSEGRETASCWMRVVQSDTGGGYGAVHI
PRVGEEVLIGYIGGDCDRPIVMHRVYNGAAKPQWHSDGLLSGFRSKEYAGSGHNEMVLDD
ATGQNRARLFSSSGNSLLHLGYLIEQNGNTRGAYLGSGFDLRTDAYGALRAGQGLYVTTH
PKQANSQPLDVTEAKQQLGSAEGLIESMSRVSEMHQAESLGTGRDALKQFADATQNSVAG
VASGGGRQDGRRRNGECQCVQGTRDAVREPGGDRDGVAAVGASGERAAHQYCQRAKHVRD
QWEIADRRHPGSHQPVRAERRDEAVCREGQGRGPGARGQRRTHRAKGREDGSGDRGCRRG
CEAGDIADVGWRVHPDQGRQNRASRTRESRFQGGAAPVQRTDEHAVSIARDAGRHVQAMR
AERAQRS
NT seq 2544 nt   +upstreamnt  +downstreamnt
atgaacgtgaccgaactggcccaggcgattcgtggcggcctgatccagcaggatcggctg
ctgaagacggacatcccgtcgttgccgaacaatgcgctcgtgccgcgtcgcgccgtaacc
cgctcggagctcggccgtgatttcagcgtaacgctcgatctggtgtccaccgcgagcgac
gtcgagctcaagacgctggtcgcgcagccgatcacgctgtggattcagcaggcggacagg
tcgtatcagccgatcaacggctatatccacacggcgcggcggctcggtgccgacggcggc
ctgtcgagttaccagctgcgcttcgcgtcgtggatgcacttcctcaagttccgtagcgac
atgcggtactggcaggaccagccggtcgacgcgatcctcgccgacgtgttcgacaggcat
ccgcaggccaggggccaataccggttcgcgctgtcgaagccgctgccgtcccgttcgtac
tgccgccagagcgaaaccgactggaacttcgtgcatcggctgatggaggacgaagggctg
ttcggcttctggcggcacagtgaagacgggaaggcgcatacgttcgtcatcactgacgat
ctgcataccgtcgatgcgctgtcgccgaataccgtcaggttcgatcgctcgggcagcggc
gccgaaaccgccggtttcacgcaatggaccgcgtcgcggaccttgcaaagtacgctgcat
acgacgcgcacgttcgactacaagtcgccgtcgtcggcgggcaatccgaacggcacgtcg
ctgccgacgaaaagcgggcagggcgagctgcccgatcaggcggaaatttacgaatacacc
ggcgcttacacgtatccggcgcaggaccgcggcgaacacctgtcgaagattcgcctcgag
gaatgggagtcgcgtgcgaagcgtttcttcggcgtgggcggcgtgcgttcgatcgacgcc
ggccggcgtttcaccctcgtcgaccatccggagcacgatcgcgatgcggcgagcgaccgc
gagttcgcggccatcggcgtcacgcgttacatcgagaacaatctgccggcctctgaccac
gaagcaagtttcccgcatagcctgcaggacgcgctggcgcaggtgaaggccgggcacggg
aaagggggcgcgttcgaggtcgggcacgacgacggctcggccgggttctatctcgtcgag
gtcgaggcgcagcgcgcgagcatgccgtaccgcagcccgttcgagcaccgcaagcccgcg
atgcagctcgagacggccgtcgtggtcggtccgaagggcgaggaggtctataccgacgcg
ctgaaccggatcaaggtcatgttcgtgtgggaccggcagagcgaaggccgcgagacggca
tcgtgctggatgcgcgtcgtgcaatcggataccggcggcggttacggcgcggtgcatatt
ccgcgcgtcggcgaggaagtgctgatcggctacatcggcggcgactgcgatcggccgatc
gtcatgcatcgtgtctacaacggggcggccaagccgcaatggcatagcgacgggctcctg
tcgggcttccggtcgaaggagtatgcggggtcggggcacaacgagatggtgctcgacgac
gcgactgggcagaaccgcgcgcgcctgttcagcagcagcgggaattcgctgcttcatctc
ggctatctgatcgagcagaacggcaacacccgtggtgcgtatctcggctcgggtttcgat
ctgcgcacggatgcgtacggcgcgctgcgcgcgggccaagggctgtacgtgacgacgcat
ccgaagcaggcgaacagtcagccgctcgatgtgacggaggcgaagcagcagcttggcagt
gcagaagggttgatcgagtcgatgtcgcgggtgagcgagatgcatcaggccgagagcctc
ggtaccggtcgcgatgcgctgaagcagttcgccgatgcgacgcagaacagcgtggcgggg
gtggcctcggggggggggcggcaggacggccggcggcggaacggggaatgccaatgcgtt
caaggaacccgtgatgctgttcgcgagcccggcggggatcgggatggcgtcgcagcagtc
ggtgcatctggcgagcgagcagcacaccaatattgtcagcgggcaaagcacgttcgtgac
cagtgggaaatcgctgatcgccggcatccgggatcgcatcagcctgttcgcgcagaacgc
cgggatgaagctgtttgccgggaagggcaaggtcgaggtccaggcgcacgcggacaacgt
cgaactcaccgcgcaaaaggccgtgaagatggtagcggcgaccgaggctgtcgacgtggc
tgcgaagcaggagatattgctgacgtcgggtggcgcgtacatccggatcaagggcggcaa
aatcgagcttcacgcacccgggaaagtcgatttcaagggggcgcagcaccagttcagcgg
accgacgagcatgcagtatccattgcccgcgatgccgggcggcacgtgcaagcaatgcgt
gctgaacgcgcacagcggtcgtga

DBGET integrated database retrieval system