KEGG   Burkholderia cenocepacia AU1054: Bcen_2631
Entry
Bcen_2631         CDS       T00363                                 

Definition
(GenBank) ImpA-like protein
  KO
K11902  type VI secretion system protein ImpA
Organism
bcn  Burkholderia cenocepacia AU1054
Brite
KEGG Orthology (KO) [BR:bcn00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bcn02044]
    Bcen_2631
Secretion system [BR:bcn02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Bcen_2631
SSDB
Motif
Pfam: ImpA_N
Other DBs
NCBI-ProteinID: ABF77529
UniProt: A0A0H2XTR5
Structure
PDB: 
6H8F 6HS5 6H8E 6HS6

Position
1:complement(2896514..2897635)
AA seq 373 aa
MPINLPELLTPISDASPSGDDLLFSNEFDAIQDARRYDDPTLDQGEWVTEIKEADWGFVV
DHAGELLRTRTKDLRLAVWLTEALALEDGITGLTEGYALLEGLCRDFWDTFHPLPEDDDI
EHRLGNVAWLSGRTAELLRAVPLTDGASNAFSTLDWEVAQHVAQSIKRDPEHADDIARGK
PSIDQIDASRRVTSIAFYTALLANLKAFEFALDAFEERLVERAGDSAPSFRQARDAFETV
YRLAERFAREQGYTGSAPHAQAAPQAQPERVEPVFGQPIQTEETHVQQQTASRPPVTQMI
AGIQNRAQAVDQLRAVARYFRQTEPHSPVAYLADKAAEWADMPLHKWLESVVKDDGSLSH
IRELLGVRPDEQA
NT seq 1122 nt   +upstreamnt  +downstreamnt
atgccgatcaatctccccgagctgctgacaccgatcagcgatgcgtcgcccagcggcgac
gacctgctgttttcgaacgaattcgacgcgatccaggacgcgcggcgctacgacgacccg
acgctcgaccagggcgaatgggtaaccgagatcaaggaggccgactggggcttcgtcgtc
gaccatgcgggcgagctgctgcgcacccgcaccaaggacctgcggctcgccgtgtggctg
accgaggcgctcgcgctcgaggacggcatcaccggcctcaccgaaggctatgcgctgctc
gaaggcctgtgccgcgacttctgggacacctttcacccgctgcccgaggacgacgacatc
gagcaccggctcggcaacgtcgcgtggctgtccggccgcacggccgagctgctgcgcgcg
gtgccgctgacggacggcgcatcgaatgcgttcagcacgctcgattgggaagtcgcgcag
cacgtcgcgcagtcgatcaagcgcgaccccgaacatgccgacgacatcgcgcgcggcaag
ccgtcgatcgaccagatcgacgcgtcgcggcgcgtgacgtcgatcgcgttctacacggcg
ctgctggcgaacttgaaggcgttcgaattcgcgctcgatgcgttcgaggagcggctcgtc
gagcgcgcgggcgattcggcgccgagcttccggcaggcgcgcgacgcgttcgagaccgtg
taccggctcgccgagcgctttgcgcgcgaacagggctatacgggcagcgcgccgcacgcg
caggcggcgccgcaggcccagcccgaacgcgtcgagccggtgttcggccagccgatccag
accgaggagactcacgtgcagcagcagaccgcttcgcgtccgccggtgacgcagatgatc
gccggcatccagaaccgcgcgcaggccgtcgaccagttgcgcgcggtggcgcgctatttc
cgtcagaccgagccgcacagcccggtcgcgtatcttgccgacaaggcggccgagtgggcc
gacatgccgctgcacaagtggctcgagagcgtcgtgaaggacgacggctcgctgtcgcac
attcgcgagctgctgggggtgaggcccgacgagcaggcgtga

DBGET integrated database retrieval system