KEGG   Burkholderia cenocepacia AU 1054: Bcen_2638
Entry
Bcen_2638         CDS       T00363                                 

Definition
(GenBank) protein of unknown function DUF877
  KO
K11900  type VI secretion system protein ImpC
Organism
bcn  Burkholderia cenocepacia AU 1054
Brite
KEGG Orthology (KO) [BR:bcn00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bcn02044]
    Bcen_2638
Secretion system [BR:bcn02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Bcen_2638
SSDB
Motif
Pfam: VipB VipB_2
Other DBs
NCBI-ProteinID: ABF77536
UniProt: A0A0H2XSR5
Position
1:complement(2904486..2905976)
AA seq 496 aa
MNQQTAAAQASGAEYAAGTSLLDDIVEKSKVAKSDSEHARAKDLIGELVHQVLDGTVIVS
DNLSATIDARVAELDRLISTQLSAVMHAPEFQRLESTWRGMDYLVKESNTGQTIKIKALH
APKRDLVRDFKGASEFDQSALFKKVYEEEFGTFGGSPFGALIGDYEISRQPEDMYFIEQM
SHVAAAAHAPFIASASPELLGLESFSDLGKPRDLGKVFDTVEYAKWKSFRDAEDSRYVGL
TLPRFLGRLPFNPKDGQTAENFNFVEDVDGTDHDKYLWCNAAWAFAARLTAAFDDFGWCA
AIRGVEGGGLVEDLPTHTFKTDDGEVALKCPTEIAITDRREKELSDLGFIPLVHCKNSDY
AAFFAAQSVQKPKKYSTDSANANAVLSAQLQYIFSVSRVAHYLKAMMRDKIGSFASAQNV
ETFLNRWISQYVLLDDNASQEQKAQFPLREASIQVSEIPGKPGSYRSVAFLRPHFQLDEL
SISLRLVADLPKPANS
NT seq 1491 nt   +upstreamnt  +downstreamnt
atgaaccagcaaacggctgcggcccaagcgagcggcgcggaatacgccgccgggacttcg
ctgctcgacgacatcgtcgagaagagcaaggtcgcgaaatccgattccgagcatgcgcgt
gcgaaggacctgatcggcgaactcgtgcatcaggtgctcgacggcacggtgatcgtgtcg
gacaacctgtcggccacgatcgacgcgcgcgtcgcggagctcgaccgcctgatttccacg
cagctttccgccgtgatgcacgcgccggaattccagcgcctcgaaagcacgtggcgcggg
atggattatctggtcaaggaaagcaacacgggccagacgatcaagatcaaggcgctgcac
gcgccgaagcgcgatctcgtgcgcgatttcaagggcgcgagcgagttcgaccagagcgcg
ctgttcaagaaggtctacgaagaggaattcggcacgttcggcggctcgccgttcggtgcg
ctgatcggcgattacgagatctcgcgccagccggaagacatgtacttcatcgagcagatg
tcgcatgtcgcggcggccgcgcatgcgccgttcatcgcgtcggcgtcgccggagctgctc
ggcctcgagtcgttctccgacctcggcaagccgcgcgacctcggcaaggtgttcgacacc
gtcgaatacgcgaagtggaagtcgttccgagacgccgaggattcgcgctacgtcggcctg
acgctgccgcgctttctcggccgcctgccgttcaatccgaaggacggccagaccgcggag
aacttcaacttcgtcgaggacgtcgacggcaccgatcacgacaagtacctgtggtgcaac
gcggcatgggccttcgcggcccgcctgacggccgcgttcgacgacttcggctggtgcgcg
gcgatccgcggcgtcgaaggcggcggcctcgtcgaggatctgccgacccacacgttcaag
accgacgacggtgaagtcgcgctgaagtgcccgaccgaaatcgcgatcaccgatcgccgc
gagaaggagctgagcgatctcggcttcatcccgctcgtccattgcaagaactcagattac
gccgcgttcttcgctgcgcagtcggtgcagaagcccaagaaatacagcaccgacagcgcg
aacgcgaatgccgtcctgtccgcccagcttcagtacatcttctcggtatcgcgcgtcgcg
cactacctgaaggcgatgatgcgggacaagatcggcagcttcgcatcggcgcagaacgtg
gagactttcctcaaccggtggatttcgcagtacgtcctgctcgacgacaacgcctcgcag
gaacagaaagcgcaatttccgctgcgcgaggcatccatacaagtgtcggagattccgggc
aagccgggctcgtatcgttcggtcgcgttcctgcgcccgcactttcagctcgacgaactc
tcgatttctctgcgacttgtcgctgatctgcccaaaccggcaaattcataa

DBGET integrated database retrieval system