KEGG   Burkholderia cenocepacia AU 1054: Bcen_2642
Entry
Bcen_2642         CDS       T00363                                 

Definition
(GenBank) protein of unknown function DUF876
  KO
K11893  type VI secretion system protein ImpJ
Organism
bcn  Burkholderia cenocepacia AU 1054
Brite
KEGG Orthology (KO) [BR:bcn00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bcn02044]
    Bcen_2642
Secretion system [BR:bcn02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Bcen_2642
SSDB
Motif
Pfam: T6SS_VasE DUF5655
Other DBs
NCBI-ProteinID: ABF77540
UniProt: A0A0H2XRS4
Position
1:2908276..2909622
AA seq 448 aa
MSYSAKVLWGEGLFLRPQHFQRQDAYHEARLFESIQAIQPYNWGVRSVRIDRDALGSNVL
RVAELALVFPDGALYAAPQADDLPPPIALDTLPDGINEFVFYLALHPLRENGTNYSDDPA
AGFMTRFVSEQTSVADNFTDAAEADITFLKTQVKLIAHSEPRDQLLSVPLVRVRRTATSG
FEIDDSFVPPCLAIEASPILHQRLRQLVDALQAKVNALYGFHREPSKNIIEFRSGDIASF
WLLHTANAAFATLAHLHQHAALHPERLFQELLRLAGQLMTFSKGYTLADLPVYRHDDPGP
SFARLDLMLRELLDTVISTRYFAITLDEVRPSFHLGRLDSGKIDDKTEFYLAVSADMPSV
ELVDAVPARFKVGAPDDVDKLVLSAMPGVRLSYTPQVPPAIPVRPGACYFALDSRSPLYE
RMLQAQSAMIYAPTGINDLKFELIAVTS
NT seq 1347 nt   +upstreamnt  +downstreamnt
atgagttattcggccaaggtgctgtggggggaagggctgttcctccggcctcaacacttt
cagcgacaggacgcgtaccacgaggcgcgcctgttcgagtccatccaggcgatccagccg
tacaactggggcgtgcgctcggtgcgcatcgaccgcgacgcgctcggcagcaacgtgctg
cgggtcgccgagctcgcgctcgtgttcccggacggcgcgctgtatgccgcgccgcaggca
gacgatctgccgccgccgatcgcgctggatacgttgcccgacggcatcaacgaattcgtg
ttctatctcgcgctgcacccgctgcgcgagaacggcaccaactacagcgacgatccggcc
gccggcttcatgacgcggttcgtcagcgagcagacgagcgttgccgacaacttcaccgac
gccgccgaagccgacatcacgttcctgaagacgcaggtcaagctgatcgcgcacagcgag
ccgcgcgaccagctgctgtcggtgccgctcgtgcgtgtgcgccgcaccgcgacgtccggc
ttcgagatcgacgacagcttcgtgccgccgtgcctcgcgatcgaagcgtcgccgatcctg
caccagcggctgcgccagctggtcgacgcactgcaggccaaggtgaacgcgctgtacggc
ttccaccgcgaaccgtccaagaacatcatcgaattccgttcgggcgacatcgcgtcgttc
tggctgctgcatacggcgaacgccgcattcgcgacgctcgcgcacctgcaccagcacgcg
gcgctgcatccggagcggctgttccaggaactgctgcgcctcgcgggccagctgatgacg
ttctcgaagggctatacgctcgccgacctgcccgtgtaccgtcacgacgacccgggcccg
agcttcgcgcgcctcgacctgatgctgcgcgaactgctcgacaccgtgatctcgacgcgc
tatttcgcgatcacgctcgacgaggtgcgcccgtcgttccaccttggccgcctcgattcc
ggcaagatcgacgacaagaccgagttctacctcgcggtatccgcggacatgccgagcgtc
gagctcgtcgatgcggtgccggcccgcttcaaggtcggcgcgcctgacgacgtcgacaag
ctcgtgctgtcggcgatgcccggcgtgcggctgtcgtacacgccgcaggtgccgcccgcg
attccggtgcgccccggcgcgtgctacttcgcgctcgattcacgcagcccgctgtacgag
cgcatgctgcaggcccagtccgcgatgatctacgcgccgactggcatcaatgacctgaaa
ttcgaactgatcgcggtcacatcatga

DBGET integrated database retrieval system