KEGG   Burkholderia cenocepacia AU1054: Bcen_3076Help
Entry
Bcen_3076         CDS       T00363                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
bcn  Burkholderia cenocepacia AU1054
Brite
KEGG Orthology (KO) [BR:bcn00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Bcen_3076
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Bac_export_2
Motif
Other DBs
NCBI-ProteinID: ABF77972
UniProt: A0A0H2XU11
Position
2:complement(105370..106962)
Genome map
AA seq 530 aa AA seqDB search
MNQPASSAPNNPGSVARTRQVGYAAFLLVLVLGAVYIATHLVADLAPVREGTLFPYLLLG
AALLIALGFEFVNGFHDTANAVATVIYTHSLTPNVAVIWSGMWNFLGVMVSSGAVAFGIL
QLLPVELILQVGSGSGFAMVFALLIAAIVWNLATWYFGLPSSSSHTLIGSIIGVGLMNQL
MHGPSGTSGVDWGQALGVGKSLLLSPIVGFLCASLLLLALKALVRIPELYKEPPKDQPPP
FWIRCLLILTCTGVSFAHGSNDGQKGMGLIMLILIGTVPTAYALNKAVTPTESQTFVAVA
NQAAATFGKYTNGVAPSANPRADVEHYVQHRELTPAVLPAVAQLSTSLATAVGASGSMAA
VPQRDVDNVRNTMYLVSEAIRLMEKSGQPAFATDDKLAIDNYRKQLDHATKFIPTWVKVA
VAIALGLGTMVGWKRIVVTVGEKIGKQHLTYGQGASAELVAMLTIGAADMYGLPVSTTHV
LSSGVAGTMAANGSGLQWSTVRSLVLAWVLTLPASIALAAGLYWLFRSLA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaacccgcttcgtccgccccgaacaatccgggctccgtcgcacgcaccaggcag
gtcggctatgccgcgttcctgctggtgctcgtgctcggcgccgtctatatcgccacgcac
ctggtcgccgatctggcgccggtccgcgaagggacgctgttcccgtacctgctgctcggc
gccgcactgctgatcgcgctcggcttcgaattcgtcaacggcttccacgacaccgcgaat
gcggtcgcgaccgtgatctatacgcactcgctgacgccgaacgtcgcggtgatctggtcg
ggcatgtggaacttcctcggcgtgatggtctcgagcggcgccgtcgcgttcggcatcctg
cagttgctgccggtcgagctgatcctgcaggtcggcagcggctcgggcttcgcgatggtg
ttcgcgctgctgatcgccgccatcgtctggaacctcgcgacctggtatttcgggttgccg
tcgtcgagctcgcatacgctgatcgggtcgatcatcggcgtcgggctgatgaaccagttg
atgcacgggccgtccggcacgagcggggtcgactggggccaggcgctcggcgtcggcaag
tcgctgctgctctcgccgatcgtcgggttcctgtgtgcgtcactgctgctgcttgcgctg
aaggcgctcgtgcggattccggagctgtacaaggagccgccgaaggatcagccgccgccg
ttctggattcgctgcctgctgatcctcacctgcaccggcgtgtcgttcgcgcacggatcg
aacgacgggcagaaagggatgggcctcatcatgctgatcctgatcggcacggtgccgacc
gcctatgcgctgaacaaggccgtcacgcccaccgaatcgcagaccttcgtggcggtcgcg
aaccaggcggccgcgacgttcgggaagtacacgaacggcgtcgcgccgtccgcgaacccg
cgcgccgatgtcgaacactacgtgcagcatcgtgaactgacgcccgccgtgctgccggcc
gtcgcgcagttgtccacgtcgctcgcgaccgccgtcggcgcgtcgggatcgatggcggcc
gtaccgcagcgcgacgtcgacaacgtgcgcaacacgatgtatctggtgtccgaagccatt
cgtctgatggagaagtcgggccagcccgcattcgccaccgatgacaagctcgcgatcgac
aactatcgcaagcagctcgaccacgcgaccaagttcattccgacatgggtgaaggtggcc
gtcgcgatcgcgctgggcctcggcacgatggtcggctggaagcggatcgtcgtgaccgtc
ggcgaaaaaatcggcaagcagcacctgacgtacggacagggcgcttcggccgaactcgtc
gcgatgctgacgatcggcgccgccgacatgtacgggctgcccgtgtcgacgacgcacgtg
ctgtcctcgggtgtcgcgggcacgatggcggcgaacggctccgggctgcaatggagcacg
gtgcgcagcctcgtcctcgcatgggtgctgacgctgccggcatcgatcgcgctggcggca
gggctttactggttgttccggtcgctggcttga

DBGET integrated database retrieval system