KEGG   Burkholderia cenocepacia AU1054: Bcen_3083Help
Entry
Bcen_3083         CDS       T00363                                 

Definition
(GenBank) agmatinase
  KO
K12255  guanidinobutyrase [EC:3.5.3.7]
Organism
bcn  Burkholderia cenocepacia AU1054
Pathway
bcn00330  Arginine and proline metabolism
bcn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcn00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Bcen_3083
Enzymes [BR:bcn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.7  guanidinobutyrase
     Bcen_3083
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase 2-Hacid_dh UPF0489 B12-binding_2
Motif
Other DBs
NCBI-ProteinID: ABF77979
UniProt: A0A0H2XUV1
Position
2:complement(113749..114813)
Genome map
AA seq 354 aa AA seqDB search
MFTSISSHSSFPAERVKLCARPRRMIRQPHIGRDDPMNDHTHFQPLGGNEMPRCGGIATM
MRLPHVSSAEGLDACFVGVPFDLGTSNRTGARFGPRQIRTESVLLRPYNMATRAAPFDSL
QIADIGDVAINPYNLHDSIARIEAAYDAILEHDCKPITLGGDHTIALPILRAIHRKHGKV
ALIHVDAHADVNDTMMGEKIAHGTPFRRAVEEGLLHGDKVTQIGLRGTGYAAEDFDWCRE
QGFRVVQAEECWNKSLAPLMEEVRARIGDTPVYITFDIDGIDPAYAPGTGTPEIAGLTVP
QALEIIRGAMGLNIVGCDLVEVAPPYDPFGTTALLGANLAYELLCVLPGVAYRD
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgtttacgtcgatatcttcgcattcttctttcccggcggagcgcgtaaaactgtgcgcc
aggccgcgtcgcatgatacggcaaccccacatcggaagagacgaccccatgaacgaccac
acccatttccagccgctcggcggcaatgaaatgccgcgctgcggcggcatcgcgacgatg
atgcgcctgccgcacgtgtcgagcgccgaaggcctcgacgcgtgtttcgtcggcgtgccg
ttcgatctcggcacctccaaccgcaccggcgcgcgcttcggcccgcgccagatccgtacc
gaatccgtgctgctgcgcccgtacaacatggccacgcgcgcagcacccttcgattcgctg
cagatcgccgacatcggcgacgtcgcgatcaatccgtacaacctgcacgattcgatcgcc
cgcatcgaggccgcgtacgacgcgattctcgagcacgactgcaagccgatcacgctcggc
ggcgaccatacgatcgcgctgccgatcctgcgcgcgatccaccgcaagcacggcaaggtt
gcattgatccacgtcgatgcacacgccgacgtgaacgacacgatgatgggcgaaaagatc
gcgcacggcacgccgttccgccgcgcggtcgaggaagggctgctgcacggcgacaaggtc
acgcagatcggcctgcgcggcaccggctacgcggccgaggatttcgactggtgccgcgag
cagggcttccgcgtggtccaggccgaggaatgctggaacaagtcgctcgcgccgctgatg
gaagaagtgcgcgctcgcatcggcgacacgcccgtctacatcacgttcgacatcgacggc
atcgatccggcctatgcgccgggcaccggcacgccggaaatcgcgggcctcacggtgccg
caggcgctcgagatcatccgcggcgcgatggggctgaacatcgtcggctgcgatctcgtc
gaagtcgcgccgccgtacgacccgttcggcaccacggcgctgctcggcgcgaacctcgcg
tacgagctgctgtgcgtgctgccgggcgtcgcgtaccgcgactga

DBGET integrated database retrieval system