KEGG   Burkholderia cenocepacia AU1054: Bcen_3326Help
Entry
Bcen_3326         CDS       T00363                                 

Definition
(GenBank) Mandelate racemase/muconate lactonizing enzyme-like protein
  KO
K18334  L-fuconate dehydratase [EC:4.2.1.68]
Organism
bcn  Burkholderia cenocepacia AU1054
Pathway
bcn00051  Fructose and mannose metabolism
bcn01100  Metabolic pathways
bcn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bcn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Bcen_3326
Enzymes [BR:bcn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.68  L-fuconate dehydratase
     Bcen_3326
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MR_MLE_C MR_MLE_N MAAL_C
Motif
Other DBs
NCBI-ProteinID: ABF78221
UniProt: A0A0H2XVH0
Position
2:411791..413068
Genome map
AA seq 425 aa AA seqDB search
MPIIRSMRVLDVRFPTSRQLDGSDAMNPDPDYSAAYVVLETDRDGLEGHGLTFTIGRGNE
ICCAAIDAMRHLVVGLDLDWIREDMGRFWRHVTSDSQLRWIGPDKGAIHLATGAVVNAVW
DLWAKAVGKPLWRLVADLSPEELARAIDFRYLTDCLSPDEALDLLRRQAPGKAARIAALE
RDGYPCYTTSAGWLGYSDDKLRRLCREAVDEGFEYVKLKVGANLEDDIRRVTIAREVIGP
DRKLMIDANQVWEVDEAIDWVRELAFARPWFIEEPTSPDDVEGHRKIREAIAPVQVATGE
MCQNRVLFKQFIARGAIDVVQIDACRLGGVNEILAVMLMAAKYGLPVCPHAGGVGLCEYV
QHLSMIDYVCISGTKEGRVTEYVDHLHEHFVEPCVVRGAAYMPPTAPGFSIEMKPESLEQ
YRFRG
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgcctatcattcgatcgatgcgcgtcctcgacgtgcgctttccgacctcgcgccagctc
gacggctccgacgcgatgaatccggaccccgattattcggcggcctacgtcgtgctcgaa
accgaccgcgacgggctcgaaggccacgggctcacgttcaccatcgggcgcggcaacgaa
atctgctgcgcggcgatcgacgcgatgcgtcacctcgtcgtcggcctcgacctcgactgg
attcgcgaggacatgggccgcttctggcggcacgtgacgtcggacagccagttgcgctgg
atcggcccggacaagggcgcgatccacctggcgacgggcgccgtcgtcaacgcggtgtgg
gatttgtgggcgaaggccgtcggcaagccgctgtggcggctcgttgccgacctgagcccg
gaggagctggcgcgggcgatcgacttccgctacctgaccgactgcctgagcccggacgaa
gcgctcgacctgctgcgccggcaggcgcccggcaaggccgcgcggatcgccgcgctggag
cgcgacggctacccgtgctacacgacgtcggccggctggctcggctacagcgacgacaag
ctgcgccggctgtgccgcgaggcggtggacgaaggtttcgagtacgtgaagctgaaagtc
ggtgcgaacctcgaggacgacatccgccgcgtgacgatcgcgcgcgaggtgatcggcccc
gaccgcaagctgatgatcgacgcgaaccaggtgtgggaagtcgacgaggcgatcgactgg
gtgcgcgaactcgcgttcgcgcggccgtggttcatcgaggagccgacgagccccgacgac
gtcgaggggcatcgcaagatccgcgaggcgatcgcgccggtgcaggtcgcgaccggcgag
atgtgccagaaccgcgtgctgttcaagcagttcatcgcgcgcggcgcgatcgacgtcgtg
cagatcgacgcgtgccggctcggcggcgtgaacgagattctcgcggtgatgctgatggcc
gcgaagtacgggctgccggtgtgcccgcacgcgggcggcgtcgggctgtgcgagtacgtg
cagcacctgtcgatgatcgactacgtgtgcatttccggtacgaaggaagggcgcgtgacc
gagtacgtcgatcacctgcacgagcatttcgtcgaaccgtgcgtggtgcgcggcgcggcg
tacatgccgccgacggcgcccggtttctcgatcgagatgaagcccgaatcgctggagcag
taccggttccgcggctga

DBGET integrated database retrieval system