KEGG   Burkholderia cenocepacia AU1054: Bcen_3479Help
Entry
Bcen_3479         CDS       T00363                                 

Definition
(GenBank) Cytidyltransferase-related
  KO
K13522  bifunctional NMN adenylyltransferase/nudix hydrolase [EC:2.7.7.1 3.6.1.-]
Organism
bcn  Burkholderia cenocepacia AU1054
Pathway
bcn00760  Nicotinate and nicotinamide metabolism
bcn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Bcen_3479
Enzymes [BR:bcn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     Bcen_3479
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.-  
     Bcen_3479
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX CTP_transf_like NUDIX_4 FAD_syn
Motif
Other DBs
NCBI-ProteinID: ABF78373
UniProt: A0A0H2XUM5
Position
2:590566..591606
Genome map
AA seq 346 aa AA seqDB search
MSTQQNRRFDALVFIGRFQPPHRGHLNVLKSALSRAERVCVLIGSTDKPRTIKDPFSFDE
RRQMLASLLDASERDRVTIAPLQDSTYNDGDWVRWVQDAVAVALGDVAQRKVGLIGHEKD
ATSYYLRMFPQWELVDVDATEDIFATEIRDQYFAERTNSFVQWAVPEPVFGWLERFRTQP
EFAQLKSEAEFIAAYRKAWAAAPYPVTFVTVDAVVVHSGHILLVRRRSEPGRGLWALPGG
FVNQDERLDAACIRELREETGLKLPEPVLRGSIKDRQVFDHPTRSLRGRTITHACLFNFP
TGELPRVKGSDDADKARWVPLNEFAQMRNVMFEDHFDIAYHFLGKL
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgagtacgcaacagaaccggcgcttcgacgcgctcgttttcattggtcgtttccagcct
ccgcatcgtggtcacctgaacgtgctgaagtcggcactgagtcgggctgaacgcgtgtgc
gtgctgatcgggtcgaccgacaagccccgcaccatcaaggacccgttctcgttcgacgag
cgccgccagatgctggcttcgctgctcgacgcgtccgagcgcgatcgcgtgacgatcgcc
ccgctgcaggattcgacctacaacgacggcgactgggtgcgctgggtgcaggatgcggtg
gccgtcgcgctcggcgacgtcgcgcaacgcaaggtcgggctgatcggccacgagaaggac
gccacgtcgtattacctgcggatgttcccgcaatgggagctcgtcgacgtcgacgcgacg
gaagacattttcgccaccgagatccgcgaccagtatttcgccgaacgcaccaacagcttc
gtgcagtgggccgtgccggaacccgtgttcggctggctcgagcgttttcgcacgcagccg
gaattcgcgcaactgaagtcggaagccgaattcatcgccgcgtatcgcaaggcgtgggcg
gccgcgccgtatccggtcacgttcgtgacggtcgacgcggtggtcgtgcactcggggcat
atcctgctcgtgcgccgccgcagcgaaccgggccgcggcctgtgggcgctgccgggcggc
ttcgtgaaccaggacgagcggctcgatgcggcgtgcatccgcgagctgcgcgaggaaacc
ggcctcaagctgccggagcccgtactgcgcggctcgatcaaggatcgccaggtgttcgat
cacccgacgcgttcgctgcgcggccgcacgatcacgcatgcgtgcctgttcaacttcccg
accggcgagttgccgcgcgtgaagggcagcgacgacgccgacaaggcgcgctgggtcccg
ctcaacgaattcgcgcagatgcgcaacgtgatgttcgaggatcacttcgacatcgcgtat
cacttcctggggaagctgtga

DBGET integrated database retrieval system