KEGG   Burkholderia cenocepacia AU1054: Bcen_5133Help
Entry
Bcen_5133         CDS       T00363                                 

Definition
(GenBank) Alcohol dehydrogenase GroES-like protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
bcn  Burkholderia cenocepacia AU1054
Pathway
bcn00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:bcn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Bcen_5133
Enzymes [BR:bcn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     Bcen_5133
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     Bcen_5133
    1.1.1.-  
     Bcen_5133
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 ADH_N_assoc Glu_dehyd_C Methyltransf_25 Methyltransf_11 Methyltransf_12 DZR TrkA_N
Motif
Other DBs
NCBI-ProteinID: ABF80007
UniProt: A0A0H2Y0K5
Position
2:2416870..2417991
Genome map
AA seq 373 aa AA seqDB search
MRALQWHGPRDVRLVEIDTPRVGPGDVRIAVAYCGICGSDLHEYADGPHAIPVDAPHPLS
RRTAPLTLGHEFCGTVVEVGADVTTLRAGDRVAVEPEYRCSQCAYCRSGSYNLCVSMGFA
GLMGDGGMADFAVVPAYMLHRLPDGVSLEQAAVMEPAAVALHALRRGELRLGETCAVFGL
GPIGLLLIMLAKLQGATTIVAVDVSPERLAAATRFGATHAFDARTLDAAALQDAIRAATG
GLGVDTSFEAAGLQATFESAMRALRKGGRVVMVGLMPHAGFDAFRAVNDELTVTTSVGYR
HAYEDLLRIVASGALDLTSIVTRTVSLEDAVADGFDALLADRAQIKILVSPAQRPARRAS
TTGSIEHESSVGV
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcacttcaatggcatggcccgcgcgacgtccgtctcgtggaaatcgacacgccg
cgcgtcggccccggcgacgtgcgcatcgcggtcgcgtattgcgggatctgcggcagtgac
ctgcatgaatacgcggacggcccgcacgcgattccggtcgatgcgccgcatccgctgtcg
cgccgcaccgcgccgctgacgctcggccacgagttctgcggcaccgtcgtcgaagtcggc
gccgacgtgacgacgctgcgcgcgggcgaccgcgtcgcggtcgaacccgagtatcgctgc
agccagtgcgcgtactgccgttcggggtcgtacaacctgtgcgtgtcgatgggcttcgcc
gggctgatgggcgacggcgggatggccgacttcgcggtcgtgccggcctacatgctgcat
cggctgcccgacggcgtgagcctcgaacaggccgcggtaatggagccggccgccgttgca
ctgcatgcgctgcggcgcggcgaactgcggctcggagagacctgcgcggtgttcgggctc
gggccgatcggcctgctgctgatcatgctcgcgaagctgcagggcgcgaccacgatcgtc
gccgtcgacgtgtcgcccgaacggctcgcggccgccacacgcttcggtgcgacgcacgcg
ttcgatgcgcgcacgctcgatgccgccgcgctgcaggacgcgattcgcgcggccacgggc
gggctcggcgtcgatacgagtttcgaggcggccggattgcaggccacgttcgaatcggcg
atgcgggcactgcgcaagggtggtcgtgtcgtgatggtcggcctgatgccgcacgcgggt
ttcgacgcgttccgcgcggtcaacgacgagttgaccgtcaccacgagcgtcggctaccgg
catgcgtacgaagacctgctgcgcatcgtcgcgtcgggcgcgctcgacctcacgtcgatc
gtcacacgcaccgtgtcgctcgaggatgccgtcgccgacggcttcgacgcgctgctcgcc
gatcgcgcgcagatcaagatcctcgtttcacccgcgcaacggccggcccgtcgcgcgtcc
accaccgggagcatcgagcatgagtcgtcagtgggcgtttga

DBGET integrated database retrieval system