KEGG   Burkholderia cenocepacia AU1054: Bcen_6175Help
Entry
Bcen_6175         CDS       T00363                                 

Definition
(GenBank) Acetyl-CoA C-acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bcn  Burkholderia cenocepacia AU1054
Pathway
bcn00071  Fatty acid degradation
bcn00072  Synthesis and degradation of ketone bodies
bcn00280  Valine, leucine and isoleucine degradation
bcn00310  Lysine degradation
bcn00362  Benzoate degradation
bcn00380  Tryptophan metabolism
bcn00620  Pyruvate metabolism
bcn00630  Glyoxylate and dicarboxylate metabolism
bcn00640  Propanoate metabolism
bcn00650  Butanoate metabolism
bcn00900  Terpenoid backbone biosynthesis
bcn01100  Metabolic pathways
bcn01110  Biosynthesis of secondary metabolites
bcn01120  Microbial metabolism in diverse environments
bcn01130  Biosynthesis of antibiotics
bcn01200  Carbon metabolism
bcn01212  Fatty acid metabolism
bcn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bcn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bcen_6175
   00630 Glyoxylate and dicarboxylate metabolism
    Bcen_6175
   00640 Propanoate metabolism
    Bcen_6175
   00650 Butanoate metabolism
    Bcen_6175
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Bcen_6175
   00072 Synthesis and degradation of ketone bodies
    Bcen_6175
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Bcen_6175
   00310 Lysine degradation
    Bcen_6175
   00380 Tryptophan metabolism
    Bcen_6175
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Bcen_6175
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bcen_6175
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Bcen_6175
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bcn04147]
    Bcen_6175
Enzymes [BR:bcn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Bcen_6175
Exosome [BR:bcn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Bcen_6175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ABF81039
UniProt: A0A0H2Y3B7
Position
3:779945..781123
Genome map
AA seq 392 aa AA seqDB search
MTEAVIVSTARTPLAKSWRGAFNMTHGATLGGHVVAAALERAKLDPARVEDVIMGCANPE
GATGANIARQIALRAGLPVSVPGMTVNRFCSSGLQTIALAAQRIIAGEGEVYVAGGVESI
SCVQNEMNRHMVQEGWLVQHKPEIYWNMLQTAENVAKRYGISKERQDAYGVQSQLRAAAA
QEAGRFRDEIVPITVLAGIADKATGRLFTQEVTVSADEGIRPDTTLEGVSKIRSAVPGGV
ITAGNASQFSDGASACVVMSADAAQREGLQPLGAFRGFAVAGCEPDEMGIGPVFAVPKLL
KQAGLTVDDIGLWELNEAFAVQVLYCRDTLGIPEDRLNVNGGAIAVGHPYGVSGARLTGH
ALIEGKRRGVKYAVVTMCIGGGQGAAGLFEIL
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagccgtaatcgtatcgaccgcacgcacgccgctggcgaaatcctggcgcggt
gccttcaacatgacgcacggcgcgacgctcggcggccacgtggtcgcggccgcgctcgaa
cgcgcgaagctcgacccggcgcgcgtcgaggacgtgatcatgggctgcgcgaaccccgaa
ggcgcgacgggcgcgaacatcgcgcggcagatcgcgctgcgcgccggcttgccggtcagc
gtgccggggatgacggtgaaccgtttctgttcgtcggggctgcagaccatcgcgctggcc
gcgcagcggatcatcgcgggcgaaggcgaggtctatgtggccggcggcgtcgagtcgatc
tcgtgcgtgcagaacgagatgaaccggcacatggtccaggaaggctggctcgtccagcac
aagcccgagatctactggaacatgctgcagaccgcggaaaacgtcgcgaagcgctacggg
atctcgaaggagcggcaggatgcctacggcgtgcagtcgcaactgcgcgccgcggccgcg
caggaagccgggcgttttcgcgacgagatcgtgccgatcaccgtgctcgcgggcatcgcc
gacaaggcgacgggccgcctgttcacgcaggaagtgacggtctcggccgacgaaggcatc
cgccccgacacgacgctcgaaggcgtgtcgaagatccgttcggcggtgccgggcggcgtg
atcaccgcgggcaatgcgagccagttctcggacggcgcatcggcatgcgtcgtgatgagc
gccgacgccgcgcagcgcgaagggttgcagccgctgggcgcgttccgcggcttcgcggtg
gccggctgcgaaccggacgaaatgggcatcggcccggtgttcgcggtacccaagctgctg
aagcaggccgggctgacggtcgacgacatcgggctgtgggagctgaacgaggcgttcgcg
gtgcaggtgctgtactgccgcgacacgctcgggatccctgaggaccgcctgaacgtcaac
ggcggcgcgatcgcggtcggccatccgtatggcgtgtcgggcgcgcgcctgacgggccat
gcgctgatcgagggcaagcggcgcggcgtgaagtacgcggtcgtcacgatgtgcatcggc
ggcgggcagggcgcggccggcctgttcgaaatcctctga

DBGET integrated database retrieval system