KEGG   Bacillus cellulosilyticus: Bcell_0163Help
Entry
Bcell_0163        CDS       T01389                                 

Definition
(GenBank) spore germination protein GerD
  KO
K06294  spore germination protein D
Organism
bco  Bacillus cellulosilyticus
Brite
KEGG Orthology (KO) [BR:bco00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    Bcell_0163
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_transf_88 DUF5061 DASH_Duo1 DUF445
Motif
Other DBs
NCBI-ProteinID: ADU28452
UniProt: E6TTB2
Position
complement(180753..181439)
Genome map
AA seq 228 aa AA seqDB search
MWYYHNKYKRVPQWHRYFEKVINNISLKKAVVYIPLLFILLLNGCAAMEDNSSQQPDYES
TKKMMVDMLKTDEGKQAIQDVLQDEEVRQNLVMEEDYVKQTIQTTLTSDEGKEYWQRVMQ
DPEFAKSFAESIQSQNEKMMKSLMKDPEYQGMMMDVLKDPEMEEKYLELMQSKEYRQQVM
TVMQDAFESPYFVAKLNDIFSNVAEEQMNKQDQEQQEEGQDSGESEEE
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
gtgtggtattatcataataaatataaacgtgttccacaatggcaccgatattttgaaaaa
gttattaataacatttccttgaagaaggccgttgtttatataccgctacttttcatcttg
ttgttaaatggctgtgcagctatggaggataatagctctcagcagccagattacgaaagc
acaaaaaaaatgatggtagatatgttaaaaacagatgaagggaaacaagccattcaagat
gtacttcaagatgaggaagttcgtcaaaaccttgttatggaagaggattatgtcaaacaa
acgattcagactacactaacctccgatgaaggaaaagaatattggcaaagagtcatgcaa
gatcctgaatttgcaaaatcatttgctgagagtattcaaagtcaaaatgaaaagatgatg
aaaagcttaatgaaggatcctgaatatcagggcatgatgatggacgtattaaaggatcct
gaaatggaagaaaagtatttagaattaatgcaaagtaaggagtaccgtcaacaagtgatg
acagtcatgcaagatgcttttgaaagcccttattttgtagctaaactaaatgacattttc
tctaatgtcgctgaagagcaaatgaataaacaagatcaagaacaacaagaagaaggtcaa
gatagtggcgaaagtgaagaggaataa

DBGET integrated database retrieval system