KEGG   Bacillus cellulosilyticus: Bcell_0167Help
Entry
Bcell_0167        CDS       T01389                                 

Definition
(GenBank) Sporulation stage 0, Spo0E-like regulatory phosphatase
Organism
bco  Bacillus cellulosilyticus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SpoOE-like Dynactin_p22 DUF1706 DUF1664 Sec34 DUF4041
Motif
Other DBs
NCBI-ProteinID: ADU28456
UniProt: E6TTB6
Position
complement(185832..186008)
Genome map
AA seq 58 aa AA seqDB search
MNSTVSKKELLNQIETARDKMNKLSEKMNRTSHEVVEISTHLDDLLIKYQYLSIREKK
NT seq 177 nt NT seq  +upstreamnt  +downstreamnt
atgaatagtacagtttccaaaaaagagctgcttaatcaaatagaaacagctcgtgataaa
atgaataaattatcagaaaagatgaatagaacttcacatgaagtcgtagaaattagcact
caccttgatgatttattaataaaatatcaatacttatcaataagagagaaaaaataa

DBGET integrated database retrieval system