KEGG   Bacillus cellulosilyticus: Bcell_0168Help
Entry
Bcell_0168        CDS       T01389                                 

Definition
(GenBank) RNA polymerase, sigma-24 subunit, ECF subfamily
  KO
K03088  RNA polymerase sigma-70 factor, ECF subfamily
Organism
bco  Bacillus cellulosilyticus
Brite
KEGG Orthology (KO) [BR:bco00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:bco03021]
    Bcell_0168
Transcription machinery [BR:bco03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     Bcell_0168
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma70_r2 Sigma70_r4_2 Sigma70_r4 Sigma70_ECF HTH_Mga DUF2278 HTH_24 HTH_16
Motif
Other DBs
NCBI-ProteinID: ADU28457
UniProt: E6TTB7
Position
186205..186768
Genome map
AA seq 187 aa AA seqDB search
MDAVVKKIVIEVKKGNQQAFSELVELYKDKVYQIAYRMLGNVHEAQDVAQEAFLRAYVNI
ESYDTNRKFSTWLFRIATNLAIDRIRKKKPDFHLEDKVAGTEDLDYYSQFATEDKLPEEK
VVQYETQDWVQKEIMALPPKYRSAIILKYIEDLSLKEISNILNLPVATVKTRIHRGREAL
RKRLRET
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atggatgcggttgtaaaaaaaatagttatagaagtaaagaaaggtaatcaacaagctttc
tcagagctagttgagctatataaagataaagtttatcaaattgcatatcgaatgctaggg
aatgtgcatgaggcgcaggatgttgctcaagaagcgtttttacgtgcatatgtgaatatt
gagtcgtatgatacaaataggaagttttcaacttggctttttaggattgcaacaaactta
gctatcgatagaattagaaagaagaaaccagattttcatctcgaagataaagtggcgggg
acagaggatttagattattattctcaatttgctacagaggataaattaccagaagaaaag
gttgtccaatacgaaacacaagattgggtacaaaaagaaattatggctttaccaccgaag
tatcgatcagctatcattttgaaatatatagaagatctttctttaaaggagattagtaat
attttgaacctacccgttgctacagtgaaaacgaggattcatcgaggtagggaagcatta
aggaaacggctacgagaaacttga

DBGET integrated database retrieval system