KEGG   Bacillus cellulosilyticus: Bcell_0175Help
Entry
Bcell_0175        CDS       T01389                                 

Definition
(GenBank) hypothetical protein
Organism
bco  Bacillus cellulosilyticus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3800
Motif
Other DBs
NCBI-ProteinID: ADU28464
UniProt: E6TTC4
Position
194256..195377
Genome map
AA seq 373 aa AA seqDB search
MDYSHIYHFIASEGGVTNIEKKYILYYDETNNPRTFRLTDDGFNVNEHEFFILGGIGFEP
DKTASDDDIDELFSEFQLQGNTSEVKFKHIRHNAQDFLSLLSKPRVTTLIEWLYEKQYPI
HYSYVDNFYYTIVDIVDSMNESWFGGPDLNREVKNRLYSLIKDNHDWFVSLLIELDYPNI
KNHKMFVEKLVDWIWSVNIGDDFYLEYLRQSLKSYRDKQLVFLEDNDDRIAITDYSTFYA
NLIVTYPNADHIFDHELSVEELLNANPIELSGHKGINYKFVDSKDERLVQVSDLIVGVLR
YWMAFLESVVNIQNLSEILNGLSEIQKVKMKKFQEVLLHSLDISTGFKHGIGSNEFELKV
SFFLEFDFTFQSQ
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggattattctcacatttatcattttattgcctctgaaggaggcgtaaccaacatagaa
aaaaagtacatattgtattatgacgaaactaataatcctcgtacttttagattgacagat
gatgggtttaacgttaatgaacacgaattctttattttaggtggaattggctttgaacca
gataagactgcttctgatgatgatattgatgaactattttctgaatttcaattacaggga
aatacaagtgaagttaaatttaagcacattcgtcataatgcacaggactttttatctttg
ttatcaaaaccgagagtaactactcttattgagtggctttacgaaaaacagtacccaatc
cattactcttatgttgataatttttattacacaatcgttgatatagtggattcaatgaat
gagtcatggtttggtggaccagatttaaatagagaagtgaaaaaccgactttattcattg
attaaagataatcatgattggtttgtaagtttgctaattgagttagactatcccaacatt
aagaatcacaaaatgtttgtcgagaaacttgtagattggatatggtctgtaaacattggg
gatgatttttatcttgaatatttacggcaatcactaaaaagttacagagataagcaactg
gtatttctggaagataatgatgataggattgcaataactgattattctactttttatgcc
aatttaatagttacttaccccaatgcagaccatatttttgatcacgagctgtctgttgag
gaacttttgaacgccaatccaatagagttatcaggacataaaggtataaactataaattt
gtagattcaaaagatgaacgtttggtgcaagtatctgatttgattgtaggtgttttgcgt
tattggatggcttttttagaatcagttgttaatatacaaaatttaagtgaaatattgaat
gggctttcagaaatacaaaaagtcaaaatgaaaaagtttcaggaagttttgctccattct
cttgatataagtactggatttaagcacggaattggtagcaatgagtttgaattaaaggtt
agcttctttttagaatttgattttacttttcaaagtcaatag

DBGET integrated database retrieval system