KEGG   Bacillus cellulosilyticus: Bcell_0229Help
Entry
Bcell_0229        CDS       T01389                                 

Definition
(GenBank) Phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bco  Bacillus cellulosilyticus
Pathway
bco00010  Glycolysis / Gluconeogenesis
bco00260  Glycine, serine and threonine metabolism
bco00680  Methane metabolism
bco01100  Metabolic pathways
bco01110  Biosynthesis of secondary metabolites
bco01120  Microbial metabolism in diverse environments
bco01130  Biosynthesis of antibiotics
bco01200  Carbon metabolism
bco01230  Biosynthesis of amino acids
Module
bco_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bco_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcell_0229
  09102 Energy metabolism
   00680 Methane metabolism
    Bcell_0229
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bcell_0229
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bco04131]
    Bcell_0229
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bco04147]
    Bcell_0229
Enzymes [BR:bco01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Bcell_0229
Membrane trafficking [BR:bco04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Bcell_0229
Exosome [BR:bco04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Bcell_0229
  Exosomal proteins of melanoma cells
   Bcell_0229
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ADU28517
UniProt: E6TU57
Position
250995..251546
Genome map
AA seq 183 aa AA seqDB search
MNKNIYIIRHCEAIGQSSDSPLTERGFTQANELSDFLSNIKVKVDRIISSPYLRAVQTIK
PFAENKNMELEMDRRLTERILSSTFFPDWMDKLEATFKDMDLKYEGGQSSNEAMNRIVEV
VNDIVASDSENTIIVAHGGVISLLLNHYDKKFGFEQWKGLSNPDVYQLRILQNNFDIKRL
WND
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaatatatacataattagacattgtgaagcgataggacaatcttctgattca
ccattaacggaaagaggattcacacaagcaaatgaactatctgactttctatcgaatata
aaggtaaaggttgatagaattatttccagtccttacttgcgagcggttcaaacgataaag
ccatttgcagagaataaaaatatggaacttgagatggataggcgactaactgaacgtata
cttagctccaccttttttccagattggatggataaactggaagcaacattcaaggatatg
gatttgaagtatgaaggtggacaatccagtaatgaagccatgaatcgaattgtagaagtt
gtaaatgacattgtggcaagtgattctgaaaatacgattatcgtggcacatggaggagtt
atatccttattattaaatcactatgataagaaatttggctttgagcaatggaaaggtctg
agtaatccagacgtgtatcaattgaggatattacaaaacaactttgatattaaacgatta
tggaatgattaa

DBGET integrated database retrieval system