KEGG   Bacillus cellulosilyticus: Bcell_0230Help
Entry
Bcell_0230        CDS       T01389                                 

Definition
(GenBank) hypothetical protein
Organism
bco  Bacillus cellulosilyticus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ThrE_2
Motif
Other DBs
NCBI-ProteinID: ADU28518
UniProt: E6TU58
Position
252024..252359
Genome map
AA seq 111 aa AA seqDB search
MNNYYWIVSAIVNYVLGIVFVIPGGFLYIFILYLLEETVGWVIDPTLEPDFLLGALFLAT
ITGLFYFPILILINVFIYKRLLAKKYLYYLFVVFFLALGVFSYLYYKLYLF
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
ttgaataactattattggattgtaagtgcgatagtcaactatgtgttaggaatcgtattt
gttattcccggtggattcttgtatatttttatcctttatctgttggaagagacagtgggg
tgggtaatagaccctactttggaaccggattttctactaggggcgttgtttctcgcaaca
ataactggtcttttctattttcctattttaatattaatcaatgtctttatttataagcga
ttacttgctaagaaatatttgtattatctatttgttgttttctttttggcattgggtgtt
ttttcgtatctctattacaaattgtatttattttaa

DBGET integrated database retrieval system