KEGG   Bacillus cellulosilyticus: Bcell_0245Help
Entry
Bcell_0245        CDS       T01389                                 

Definition
(GenBank) transcriptional regulator, LysR family
Organism
bco  Bacillus cellulosilyticus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1 PBP_like NMT1_3 MarR_2
Motif
Other DBs
NCBI-ProteinID: ADU28532
UniProt: E6TU72
Position
262669..263559
Genome map
AA seq 296 aa AA seqDB search
MELHQLRSFYYVATYLNFSRAAEKLLVSQPAVSRQIEALERLYGLPLFYRSKKKVELTPA
GRELLTYAKKMMTLAEDAKEALLTLKNGDSGELHVGCGTTIGNFAITALVVHFQKKYPNI
HIHLDIDNTDTIINKLNERKLDVAIIAKDVDREAFNVDSLFQDNIHLVCLAEEMQKYKQS
QSLDQLENETYILRKRGSHTRECVDEYFKTMNFQPQNIIEVNNNEAIKQAVIQKLGVGFL
SSITYKIEREHQILRQIRLQKPSKREFSFIYPKGKYYSTVMEMFHTFLKDNMSKIT
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggaactacaccagttaagatcgttttattatgtagcgacgtatttaaacttttcaaga
gctgcagaaaagctcttggtgagtcagccagcagtatcgcggcaaatagaggctctagag
cgcctttatggactcccattgttttaccgatctaagaaaaaagtagagttaacccctgcc
ggaagagagcttttaacttatgcaaaaaaaatgatgacgttagctgaggatgcaaaagaa
gctttattaacacttaaaaatggtgatagtggagaattacatgtaggttgtggaacgaca
attggtaattttgctattacagcattagttgtacatttccaaaagaagtatcctaatatt
catatccatctagatatagataatactgatacaatcattaataaattaaatgaacggaag
ctagatgttgccattattgcaaaggatgttgaccgggaggcgtttaacgtcgattcgctt
tttcaagataacattcatttagtatgtttagcggaggaaatgcaaaagtacaaacagagt
caatcgttagaccaactagaaaatgaaacgtacattttacgaaagcgaggatcacacaca
cgagaatgtgtcgatgagtatttcaaaacaatgaactttcagccgcaaaatatcattgaa
gtcaataataacgaagcaattaagcaagcagttatacaaaaacttggtgtcggatttctt
tcctctattacatacaaaatagaacgtgagcaccaaatactacgtcaaattcgattgcaa
aaacctagtaaaagagagttttcttttatttatccaaagggaaaatactattcaacggtt
atggaaatgtttcataccttcctaaaagataatatgagtaaaattacataa

DBGET integrated database retrieval system