KEGG   Bacillus cellulosilyticus: Bcell_0248Help
Entry
Bcell_0248        CDS       T01389                                 

Definition
(GenBank) Rieske (2Fe-2S) iron-sulfur domain
  KO
K00363  nitrite reductase (NADH) small subunit [EC:1.7.1.15]
Organism
bco  Bacillus cellulosilyticus
Pathway
bco00910  Nitrogen metabolism
bco01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bco00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    Bcell_0248
Enzymes [BR:bco01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.15  nitrite reductase (NADH)
     Bcell_0248
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rieske_2 Rieske
Motif
Other DBs
NCBI-ProteinID: ADU28535
UniProt: E6TU75
Position
268143..268460
Genome map
AA seq 105 aa AA seqDB search
MNAIQEKVKVLELAQLPQLIGKEVEIKGESIAIFHLSNGDVRAVASRCPHTNGPLAEGIV
AGEFVYCPLQDWKVSLVTGEVQKPDDGKVVTYETEVIDGYVYVVV
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgaatgctatacaagaaaaagtaaaagtattagagttagcgcaattacctcagttaatc
ggtaaggaagtagaaataaaaggcgagtcgatcgcgatttttcacttaagtaatggtgat
gtacgcgcagtagcaagccgctgtcctcacacaaatggtccactagcagaagggatcgta
gcaggagaatttgtttattgcccacttcaagattggaaagtctctttagtgactggggaa
gtacaaaagccagacgatggtaaagtggtaacgtatgagacggaggtcattgatggctat
gtatacgttgtggtgtaa

DBGET integrated database retrieval system