KEGG   Bacillus cellulosilyticus: Bcell_0250Help
Entry
Bcell_0250        CDS       T01389                                 

Definition
(GenBank) two component transcriptional regulator, LuxR family
  KO
K07689  two-component system, NarL family, invasion response regulator UvrY
Organism
bco  Bacillus cellulosilyticus
Pathway
bco02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Bcell_0250
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bco02022]
    Bcell_0250
Two-component system [BR:bco02022]
 NarL family
  BarA-UvrY (no operon) [MD:M00475]
   Bcell_0250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GerE Sigma70_r4_2 Response_reg Sigma70_ECF HTH_23 HTH_17 Sigma70_r4 HTH_10 HTH_28 HTH_7 Terminase_5 HTH_29 HTH_Tnp_ISL3 HTH_38 HTH_5
Motif
Other DBs
NCBI-ProteinID: ADU28537
UniProt: E6TU77
Position
270126..270740
Genome map
AA seq 204 aa AA seqDB search
MRLLIGLDHELLRNGLVHLLKDVRQVEYMVLATSTEMFIESVQKYEFDLIVVDADLRGAG
GLRSLISILEILPHTTKKVFMYNSLHPELEELLMNKDIQGLFYEQSPLGDLMSFFEKVLN
GEQAFLNNGSPRNYREIDEEFHELSKREEEVFYMKLRGYTVKDTAQILNISPKTVENHRR
NIRKKLNIHKGSEWYDWGKKLGVI
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgagactgttaatagggttagaccatgagctattaagaaatggtttagtacacctttta
aaagatgttcgacaagttgaatatatggtgttagcaacttcaacagaaatgtttatcgag
tcagtccaaaagtatgaatttgatttaatcgttgtcgacgctgaccttcgaggagcaggc
ggattacgaagcctcatctccatccttgaaattttacctcacacaacgaaaaaggtgttc
atgtataatagtttacacccagaattagaagaattgttaatgaataaagatattcaaggc
cttttttacgagcaatctcctttaggagacttaatgagttttttcgaaaaggttttgaat
ggtgagcaagcgttcttaaataatggtagtcctagaaactacagagaaatagacgaggag
tttcacgagctttcaaagcgtgaagaagaagtattttatatgaagcttcgtggctacact
gttaaagatacagcacaaatattaaacatttctccaaagactgtggagaaccatcggcga
aatattagaaagaagttgaacatacataaaggcagtgaatggtatgattggggaaaaaaa
ttaggtgtcatttaa

DBGET integrated database retrieval system