KEGG   Bacillus cellulosilyticus: Bcell_0251Help
Entry
Bcell_0251        CDS       T01389                                 

Definition
(GenBank) ABC transporter, CydDC cysteine exporter (CydDC-E) family, permease/ATP-binding protein CydD
  KO
K16013  ATP-binding cassette, subfamily C, bacterial CydD
Organism
bco  Bacillus cellulosilyticus
Pathway
bco02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bco00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Bcell_0251
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bco02000]
    Bcell_0251
Transporters [BR:bco02000]
 ABC Transporters, Eukaryotic Type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    Bcell_0251
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_21 MMR_HSR1 AAA_29 NACHT RsgA_GTPase FtsK_SpoIIIE AAA_16 Pox_A32 MobB
Motif
Other DBs
NCBI-ProteinID: ADU28538
UniProt: E6TU78
Position
271056..272783
Genome map
AA seq 575 aa AA seqDB search
MKQLKEIARSQKKEMYVLLCLSILIGLVIVGQAYFIVEIVDRVFLQGETFQAVLPFLGGL
VLVLIARAIFSYANGRTGISMAAKVKKDYRRALLKKYSTNPIQASLKGQSGQKVSVLLDS
VDEIDSYFSKYYPQMIQTSIVPLIILIAIFSQNWVSGLIMVVTAPFIPIFMIVIGSATQK
KSEQQMDKLAAFSGRFLDILQGLTTLKLFGRAKKQRDVIQQSSLDYREATMTVLKTAFLS
SLALEFISMLSIALVALEVGLRLVIYGHLTFFTAFFVLILVPEFFNSLKELGSAFHTGRG
SMGAANKIHEELEEKEQPVIWGSKALDKKPVTIELRHASFRYGESGFSLENIDATINPLS
EVAIVGRSGSGKTTLLHLLSGIIPTTEGDVFVNGNKLFDYKETDWFDELSYISQNPYLFS
GTIAENIAIGGKKDATRQEIIAAAEKAGIAEMIEDLSEGYDTKIGEAGRGLSGGEKQRVA
LARAFLKKPSIVLFDEPTVGLDLQTERILQRSIKELSETATIITVAHRLHTIKNADQILF
LSDGQLLGKGTHEELLASVEEYRHMVAAQQGGNAG
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaactaaaggaaattgcacgctcccaaaaaaaagaaatgtatgtgcttttatgt
ttatcgattttaattggattggtcatcgttggtcaagcttactttattgttgaaattgtt
gatagggtgtttttacaaggagaaacgtttcaggccgttttaccatttctaggcggtctt
gttttagtgctgattgctagagctattttttcttatgctaatggacgaacaggcattagc
atggctgccaaagtgaaaaaggattacaggcgagcattattaaaaaagtactcaaccaat
cctattcaagcttcacttaaaggacaatcaggacagaaagtaagtgttttacttgattct
gttgatgaaattgatagttactttagtaaatattatccgcaaatgatccaaacgagtatt
gtcccactcattatattaatcgctatcttttctcaaaactgggtttccggattgattatg
gtagtgacggcaccatttattccaatttttatgattgtaatagggagtgccactcaaaaa
aaatcagaacagcaaatggataaattagctgcattttcagggagatttcttgatattcta
caaggccttacgacgctaaagctttttgggcgagcgaaaaaacaacgtgatgtgattcag
caaagtagtcttgattatagggaagcaacgatgaccgtgttaaagacagcctttttgtca
tctttagcactggaattcatttcgatgctgagtattgcgttagttgcgctcgaggtaggc
ctacggcttgtcatatatgggcatctcacctttttcacagcgtttttcgtgctcatatta
gttcctgagttttttaattcgttaaaggaattagggagtgcattccacaccggaagaggt
agtatgggagcagccaataaaattcatgaggagcttgaagaaaaagaacagcctgttatt
tggggaagtaaagcactggataaaaaaccagttaccattgaattacgtcatgctagcttt
cgctatggagaatcaggtttttcacttgaaaatatagatgcgacaattaatccgttaagc
gaagtagcaattgttgggcgtagcggctccggaaaaacgacgttacttcatttgctatca
gggattattcctactactgaaggagatgtgttcgttaatggaaacaagctttttgactat
aaggaaactgattggtttgatgagctaagttatatttcccaaaacccttatcttttttct
ggaacaattgcagaaaatatcgctattggtgggaagaaagatgcaactcgacaagagatc
atcgccgcagcggaaaaggccggtatagccgaaatgatagaagacctttccgaaggctat
gacacaaaaattggagaagcgggacgaggactttctggtggagaaaagcaacgtgttgct
cttgcacgagcatttttaaagaaaccatctatcgttttatttgatgaaccgacagtagga
ctagatttacagacggaaagaatactacagcgctcaataaaggaactgtcagaaacagca
acgatcatcactgtcgcgcaccgtcttcatacgataaaaaatgcagatcaaattctattc
ttatctgatgggcaattgctaggaaaagggacgcatgaagagctacttgcgtcggtggag
gaatatcgtcatatggttgctgctcagcaaggggggaatgcaggatga

DBGET integrated database retrieval system