KEGG   Bacillus cellulosilyticus: Bcell_0255Help
Entry
Bcell_0255        CDS       T01389                                 

Definition
(GenBank) cytochrome bd-type quinol oxidase subunit 2-like protein
  KO
K00426  cytochrome bd ubiquinol oxidase subunit II [EC:1.10.3.14]
Organism
bco  Bacillus cellulosilyticus
Pathway
bco00190  Oxidative phosphorylation
bco01100  Metabolic pathways
bco02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bco00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Bcell_0255
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Bcell_0255
Enzymes [BR:bco01000]
 1. Oxidoreductases
  1.10  Acting on diphenols and related substances as donors
   1.10.3  With oxygen as acceptor
    1.10.3.14  ubiquinol oxidase (electrogenic, non H+-transporting)
     Bcell_0255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cyt_bd_oxida_II FAP206
Motif
Other DBs
NCBI-ProteinID: ADU28542
UniProt: E6TU82
Position
complement(276927..277940)
Genome map
AA seq 337 aa AA seqDB search
MDYEIIGITVLWTFLYGYLIVASIDFGAGFFSYYTKITKKNHITHNIIQRYLSPVWEVTN
VFLVFFFIGIVGFFPSTAYYYGTALLIPGSVAIILIAIRGSYYAFATYGAKDSNFYSFLY
GATGLLIPASLSTVLTISEGGYVSVEDGKVQLLYGELFTSLYSWGVVILAIVSVLFISAS
FLTYYASRAKDLDALELLRKYALVWAFPAIIMGVVVFFLLGNQNPEHYQNMLDIWWVFAV
SFINFAIATYLIWKRKNYGTAFILVMLQYFTAFYGYGISHFPYLLYPYLTIYDGFTNETM
AIALIIAFIAGLLLLIPSLYLLMRLFLFDADYVKGKK
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggattacgagattataggtattacggtcctttggacatttctttatggctatttaatc
gtagcgtcgattgatttcggcgctgggttctttagctactatacaaaaattacgaagaaa
aaccatattacacacaacattattcagcgttatttatctcctgtttgggaagtgacaaac
gtatttttagtattcttctttatcggtattgtcggttttttcccaagcactgcttattat
tatggaaccgcacttttgattccgggaagtgtagcaatcatactaatagctattagaggt
tcatactatgcctttgcaacctacggagctaaagatagcaatttctactcgtttctttac
ggtgcgactggccttttaattcccgcttctttatctactgtgttaacgatttccgaaggt
ggatatgttagtgtcgaggatggaaaggttcagctcctatatggtgagttgtttacgagc
ctttactcttggggcgtagttattttagccattgtcagtgtgctatttatatcagcaagc
tttttaacgtactatgcatcaagagcaaaagacttagatgcactcgaattattgcgtaaa
tacgcactcgtctgggcatttccagcgatcattatgggagttgttgtattcttcctacta
ggtaatcaaaacccagagcattatcaaaatatgctagacatttggtgggtatttgccgtt
tcctttattaattttgcaattgccacttacttgatttggaaacgtaaaaattacggtact
gcttttatactcgtgatgcttcaatacttcacggcattttacggctatgggatttcacat
tttccatacttactgtacccgtacttgactatctacgatggatttacgaatgaaacgatg
gctattgcattaatcattgcttttatagctggattgcttttattaattccgtcgctttac
ctgctcatgaggttattcttatttgatgccgactacgttaaaggaaaaaaatag

DBGET integrated database retrieval system