KEGG   Bacillus cellulosilyticus: Bcell_0269Help
Entry
Bcell_0269        CDS       T01389                                 

Definition
(GenBank) Coat F domain protein
  KO
K06329  spore coat protein F
Organism
bco  Bacillus cellulosilyticus
Brite
KEGG Orthology (KO) [BR:bco00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    Bcell_0269
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Coat_F DUF2202
Motif
Other DBs
NCBI-ProteinID: ADU28556
UniProt: E6TU96
Position
290521..290994
Genome map
AA seq 157 aa AA seqDB search
MSQGHLAWHETLEIHELVAAQSIGLMKMKKAIKDINNQELHGIYESAIKGVTNNLMELIA
FYPDMPRAESTMTEKELEGLYAGDLLTFSKMSVRNYAIAITEAATPEVRKVFQKHLNNAI
DLHGKVFNYMYKTGKYPAYDLDKLLKNDLQLARKALK
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaggtcatttagcttggcatgaaacgttggaaattcatgagttggtagcagca
caatcaatcggtttaatgaagatgaaaaaagcaataaaggatattaataaccaagaatta
catgggatttatgaaagcgcaattaaaggtgttacaaataatttgatggaacttatagca
ttttatcctgatatgccaagggcagaaagtacgatgacagaaaaagagttagaaggtttg
tatgcaggtgacttactcactttttctaaaatgagtgttcggaattacgcgattgcaatt
acagaagcggcaacacctgaagttagaaaggtatttcaaaagcatttaaataatgcgatt
gatctacatgggaaagtatttaactatatgtataaaacaggaaaatacccagcgtatgat
ttagataagctgttaaaaaatgacttgcagctagcaagaaaagcgttgaagtaa

DBGET integrated database retrieval system