KEGG   Bacillus cellulosilyticus: Bcell_0279Help
Entry
Bcell_0279        CDS       T01389                                 

Definition
(GenBank) GCN5-related N-acetyltransferase
Organism
bco  Bacillus cellulosilyticus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_4 Acetyltransf_10 Acetyltransf_1 Acetyltransf_7 FR47 DUF3749 Acetyltransf_3 Acetyltransf_9 Acetyltransf_CG
Motif
Other DBs
NCBI-ProteinID: ADU28566
UniProt: E6TUY3
Position
300179..300688
Genome map
AA seq 169 aa AA seqDB search
MEEIVIRQLEESDAAEFLDIRLNALKSNPEAFATTYKELMDSGNPLEQLKKQLKSDQSFT
YGAFINKQLVAIATIRLYAIEKMKHKGMLLGMFVSDQTRGLGVGKRLMQEVVKEARKIGL
EQIQLMVVTTNKAGKAFYESLGFETYGIENNAMKYNGEYWDEELMVLFL
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atggaagagatcgttattagacaattggaagaaagtgatgcagcggaatttctagacatt
cgtttaaacgcgttaaaaagcaatccagaagcctttgccactacatataaggaattaatg
gatagtggaaatcctttagaacagttaaagaaacaattgaaaagtgaccaatcgtttaca
tatggagcttttattaataaacagctagtagcaattgcgacgataagactgtatgcaata
gagaaaatgaagcataaaggaatgctgttgggcatgtttgtttctgatcaaacgagggga
ttaggagttggcaaaaggctgatgcaggaagtggtgaaagaagctagaaaaattgggcta
gaacagattcagctaatggttgtcacgacgaataaagcggggaaggcattttatgaatca
ttagggtttgaaacatatggtattgaaaataatgctatgaagtataacggtgaatattgg
gatgaggaactaatggtgctgtttttataa

DBGET integrated database retrieval system