KEGG   Bacillus cellulosilyticus: Bcell_0286Help
Entry
Bcell_0286        CDS       T01389                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
bco  Bacillus cellulosilyticus
Pathway
bco00010  Glycolysis / Gluconeogenesis
bco00052  Galactose metabolism
bco00500  Starch and sucrose metabolism
bco00520  Amino sugar and nucleotide sugar metabolism
bco00521  Streptomycin biosynthesis
bco01100  Metabolic pathways
bco01110  Biosynthesis of secondary metabolites
bco01120  Microbial metabolism in diverse environments
bco01130  Biosynthesis of antibiotics
bco01200  Carbon metabolism
Module
bco_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bco_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bco00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcell_0286
   00052 Galactose metabolism
    Bcell_0286
   00500 Starch and sucrose metabolism
    Bcell_0286
   00520 Amino sugar and nucleotide sugar metabolism
    Bcell_0286
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Bcell_0286
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Bcell_0286
Enzymes [BR:bco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Bcell_0286
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK FGGY_N BcrAD_BadFG Glucokinase FtsA Hydant_A_N
Motif
Other DBs
NCBI-ProteinID: ADU28573
UniProt: E6TUZ0
Position
310391..311335
Genome map
AA seq 314 aa AA seqDB search
MYIIGIDIGGTNMRVGLFKDGNMIKKTSVFTRTEEGVVAIITRLKQLIVNVLEQANIEMG
QVKGIGVGCPGPLDPWKGEIQSPPNLPGWDHIPLKKILEEEYSLPVFLHNDANAAALGEY
TFAYNRNVNNLVYITVSTGVGGGVVADGRLLLGVNGSAAEIGHMIINPNGNLCSCGNRGC
LEAQASGTGIVSKTKALLQTTKEASVLKGKSKLTSKDVFVAAENGDALCKRIIEEVQFDL
ALGLTNIVHAYNPEMVVYGGGVMQAGESFIKPVIEKAEKMILPGMKGRLTFAATKLGGEL
GLYGAAALVDYFQE
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
gtgtatattattggaattgatattggtggaacgaatatgagggtaggactatttaaagat
ggaaatatgataaaaaaaacaagtgtattcacacgtacagaagaaggtgtagtggcaatc
attactaggcttaagcagctgatagtcaatgtgctagagcaagctaatattgaaatggga
caagtgaaagggatcggtgtcggttgcccaggaccacttgacccgtggaaaggtgagata
caatccccacctaacttacctggttgggatcacatcccattaaaaaagatactagaagaa
gaatatagcttaccagtgtttttacataatgatgcaaatgctgcagctttaggtgagtat
acattcgcatataacagaaatgttaacaatctcgtatatattacggtaagtacaggggtt
ggcgggggtgtcgtagccgacggacgtttattattaggtgtaaatggcagtgctgcagaa
atagggcatatgatcattaatccaaatgggaacttgtgctcatgtggtaatagaggctgc
ctagaagcccaagcatcaggtactgggattgtttcaaaaacgaaggctcttctacaaaca
actaaggaagcgtctgtattgaaggggaaatctaagcttacttcaaaagatgtgtttgtt
gcagcagaaaatggagatgcactctgtaaaagaatcattgaagaggtgcaatttgatttg
gcattaggtttaacaaatattgttcatgcatataacccagagatggtcgtttatggtgga
ggggttatgcaggcaggtgaatcatttattaaaccagttatcgaaaaagcggaaaaaatg
attttaccaggtatgaagggaaggctcacatttgcagctaccaaattaggtggggagtta
ggtttgtacggtgcagcggctttagttgattattttcaagaataa

DBGET integrated database retrieval system