KEGG   Bacillus cellulosilyticus: Bcell_0288Help
Entry
Bcell_0288        CDS       T01389                                 

Definition
(GenBank) regulatory protein MarR
Organism
bco  Bacillus cellulosilyticus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR MarR_2 HTH_27 TrmB CCDC84
Motif
Other DBs
NCBI-ProteinID: ADU28575
UniProt: E6TUZ2
Position
312119..312571
Genome map
AA seq 150 aa AA seqDB search
MSRREMDQMFGYHIGVLSHLIQNQYNKNLSQFDLTISQAKVLYLLSHDGDKLQSELQKRL
FIQASTMNGIIDSMLKRALIEKRDSQEDRRSKVISLTEKGISIERELWVNLDHMERELLA
GFSIEEQQLLMMWLKRMKENMQEVDRDKTT
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcggcgagaaatggatcaaatgtttggatatcatataggagttttatcccatctc
atacaaaatcaatataataaaaacctatctcaatttgacttaaccatttctcaagcgaaa
gtattgtatttactttctcacgatggtgacaagctccaatcagagctacagaaaagactt
tttattcaagcttcaacaatgaatggcattatagattcgatgttaaagagagctttaatt
gagaaaagagatagtcaagaagataggcgttcaaaagtaatatcattaacggaaaaaggg
atctcaatagagcgagaattatgggtgaatctagaccatatggagcgtgagttattagct
ggtttttctatcgaagaacaacaactcttaatgatgtggttaaaaaggatgaaggaaaac
atgcaggaagtggatcgggacaaaacaacgtag

DBGET integrated database retrieval system