KEGG   Bacillus cellulosilyticus: Bcell_0294Help
Entry
Bcell_0294        CDS       T01389                                 

Definition
(GenBank) Spore coat protein X/V
  KO
K06342  spore coat protein X
Organism
bco  Bacillus cellulosilyticus
Brite
KEGG Orthology (KO) [BR:bco00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    Bcell_0294
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Coat_X DUF3662
Motif
Other DBs
NCBI-ProteinID: ADU28581
UniProt: E6TUZ8
Position
318335..318796
Genome map
AA seq 153 aa AA seqDB search
MNQEVYRSTDSKDKKWNALDPISKHPLCDTQDETQDAANKNKTLQLNEEYILIKDSCDVT
VNSTDTKAAVNLQIGLQAAIAVLISISVASSETAEKLTQELLQSSKVKQISRQQTIVENS
RNVDVSTTDTQAAVNIQILLQLLLALAVKLDIL
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
gtgaatcaggaagtatatcgctcaacagactcaaaagataaaaagtggaatgctttagat
ccaatcagtaagcacccgctttgtgatacgcaagatgaaacgcaagatgcagcgaacaaa
aataaaacattacagctcaatgaagaatatattttaattaaagattcatgtgatgtaaca
gtgaactcaactgatacgaaagcagcggttaaccttcagattggtctacaagctgcaatt
gcagttttaattagcatctcagtagcaagctcagagactgctgaaaagttaacacaagag
ctattacaatcatctaaagtgaagcaaatttctcgccagcaaacaatcgtagaaaactca
agaaatgttgatgtttcaactacagatacgcaagcagcagttaacattcaaattttacta
caactattattagcattagctgtgaagttagatatcctttaa

DBGET integrated database retrieval system