KEGG   Bacillus cellulosilyticus: Bcell_0298Help
Entry
Bcell_0298        CDS       T01389                                 

Definition
(GenBank) cold-shock DNA-binding domain protein
  KO
K03704  cold shock protein (beta-ribbon, CspA family)
Organism
bco  Bacillus cellulosilyticus
Brite
KEGG Orthology (KO) [BR:bco00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bco03000]
    Bcell_0298
Transcription factors [BR:bco03000]
 Prokaryotic Type
  Other transcription factors
   Others
    Bcell_0298
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CSD OB_RNB S1
Motif
Other DBs
NCBI-ProteinID: ADU28584
UniProt: E6TV01
Position
321019..321216
Genome map
AA seq 65 aa AA seqDB search
MTGKVKWFNSEKGFGFIEREGGDDVFVHFSAIQGEGFKTLEEGQEVEFEIVDGDRGPQAA
NVVKL
NT seq 198 nt NT seq  +upstreamnt  +downstreamnt
atgactggcaaagtaaaatggtttaattcagaaaaaggatttggatttatcgagcgtgaa
ggtggagacgacgtatttgtacacttctctgcaattcaaggggaaggcttcaaaacatta
gaagaaggccaagaggttgaattcgaaatcgttgatggcgatcgtggtccacaagctgct
aacgtagtaaaactttaa

DBGET integrated database retrieval system