KEGG   Bacillus cellulosilyticus: Bcell_0301Help
Entry
Bcell_0301        CDS       T01389                                 

Definition
(GenBank) CrcB protein
  KO
K06199  fluoride exporter
Organism
bco  Bacillus cellulosilyticus
Brite
Transporters [BR:bco02000]
 Other Transporters
  Pores ion channels [TC:1]
   Bcell_0301
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CRCB
Motif
Other DBs
NCBI-ProteinID: ADU28587
UniProt: E6TV04
Position
322768..323142
Genome map
AA seq 124 aa AA seqDB search
MNILFVALGGGIGAVCRYFLGVWLKTNTKERFIPTAMLIVNVLGSFGLGLFLNIVYGAIP
LLVDAELPFLLIGIGFFGAFTTYSTFSVEAVTLLQKKKWKAFTSYVVLSIGGSIAAFIIA
FTII
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcttgtttgttgccttaggtggcggaattggtgctgtttgtcgctattttcta
ggagtatggctgaaaacaaatacgaaggagcgttttatcccgacagccatgctcatagtg
aatgttttagggtcatttggacttgggttatttttgaacatcgtatatggtgcaattcca
ctattagtagatgctgagcttccgtttctgctgataggtattggcttttttggtgccttt
acaacgtattccacctttagtgttgaggctgtgacactattacagaagaagaagtggaag
gcatttacgagttatgttgtactttctattggaggaagtatagctgcatttatcattgct
tttacaataatataa

DBGET integrated database retrieval system