KEGG   Bacillus cellulosilyticus: Bcell_0302Help
Entry
Bcell_0302        CDS       T01389                                 

Definition
(GenBank) spore coat-associated protein
  KO
K06336  spore coat-associated protein N
Organism
bco  Bacillus cellulosilyticus
Brite
Peptidases [BR:bco01002]
 Metallo Peptidases
  Family M73
   Bcell_0302
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M73 DUF4330
Motif
Other DBs
NCBI-ProteinID: ADU28588
UniProt: E6TV05
Position
323764..324453
Genome map
AA seq 229 aa AA seqDB search
MSIKKKLSMGVLTAALGLALIGGGTFAYFSDTATQTNTFASGTIDLDVDPEVQVAMYNLK
PGDWMPRSFELQNNGSLDIKYVDLNTEYSVTDSDGDAVVPGLADEYAKQLIVQFLNNTTG
DEDYEVLFEVSLYDLANLTPEDLATKIDVDTVMTHPGIWIPVFGGGFWLKQPQYEDISEE
ITGIAAGDTADFDVQFRFNDTGERQNDLQGLNLELTWTFEGFQTDGEER
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgagtattaagaaaaagttaagcatgggagttctgactgctgcgctaggtttagcattg
atcggaggaggaacatttgcctacttcagtgatactgcaactcaaacgaatacgtttgca
tcagggacaattgatttagatgtcgatccagaagtgcaagtagctatgtataacttgaag
cctggggattggatgcctagaagctttgagcttcaaaacaacgggtcgttagatattaaa
tatgtagacttaaatactgagtactctgtaactgactcagacggtgatgcagttgtacct
ggccttgctgacgaatatgctaaacaattaattgttcaattcttaaataatacaactggt
gatgaagattacgaagtattgtttgaagtatcattgtatgacttagctaacttaacacca
gaagacttagctacaaagattgatgttgatactgtgatgacacatccaggtatttggatt
ccagtatttggaggagggttctggttgaaacaacctcaatatgaagatatttctgaagaa
atcactggtatagctgctggtgatactgcagacttcgacgtacagttccgcttcaatgac
actggtgagcgtcaaaacgaccttcaagggttaaacttagagcttacttggacattcgaa
ggattccaaactgatggtgaagaaagataa

DBGET integrated database retrieval system