KEGG   Bacillus cellulosilyticus: Bcell_0306Help
Entry
Bcell_0306        CDS       T01389                                 

Definition
(GenBank) choline/carnitine/betaine transporter
  KO
K05020  glycine betaine transporter
Organism
bco  Bacillus cellulosilyticus
Brite
KEGG Orthology (KO) [BR:bco00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bco02000]
    Bcell_0306
Transporters [BR:bco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   Bcell_0306
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BCCT DUF1109 RGS DUF445
Motif
Other DBs
NCBI-ProteinID: ADU28592
UniProt: E6TV09
Position
complement(326832..328640)
Genome map
AA seq 602 aa AA seqDB search
MDNNKFEYETKKTNIVFFISAPIVALFVLWGFIAPGHLERVSNDALALTLNNFGWFYMLC
TAFFIVFVLFLAISPFGKLRLGKPDERPEYKFYTWLGMLFSAGIGVGFVFWGVAEPALYF
LDPHPDYVDAADQYKAAAGLRYAVFHWALHPWAIFSLVALTLAYVQFRKDQPALISSAFQ
PILGDRIYGPLGKGIDVLAVLATSTGVATTFGLSALQITGGLSHLTGTIPNNPATQLTVI
AIVTVLFIFSAATGVNKGIRILSTINLTVAGLLLVFVIIFGPTLFIAESVVSTIGGYIAN
VTQMSLDLNPFGDGEWLGMYTIFFWAWHISWAPFMGIFIARISRGRTIREFVAGVLIVPS
LLAVIWFTAFGGTALDMIMGGNDHIANLVLENVEVALFVTLNELPLGMIMSGLAVILIII
FFITSADSASYVLAALSSEGSLDPKLWVKVVWGFLIASTASVLLVSGGLSGLQTASIVAA
LPFAIIMVIMIFSLLMMMSRDTRAEQLWTRRKRTRKIKKEVHSEMYDRVKDNMLDDMKED
VYEEIKEEVYEQVKEEVYDDIKEEVYEEFKEKIYDDLREDLSEQLNGELEERMDDSDDKK
KE
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
ttggacaataacaaatttgagtatgaaacgaagaaaacgaatattgtattttttatatcc
gctccaattgtcgcccttttcgttttatgggggtttatcgcacctgggcatttagagagg
gtatctaacgacgctttagctttaactttgaataacttcggctggttttatatgttatgt
actgccttttttattgtatttgttttatttttagctattagtccgtttggtaaactccgc
ttagggaagcctgacgaaaggccagaatataaattttatacttggctaggtatgcttttt
tctgcaggtattggtgtggggtttgtattttggggcgttgctgagcctgctttatatttc
ttagatccacatccagattatgttgatgctgcagatcagtataaagccgctgctgggctt
cgatatgctgtatttcactgggcgctgcatccgtgggcgattttctcattagttgcatta
acacttgcctacgttcagttcagaaaagatcaaccggccttaattagctctgcctttcaa
ccaatattaggagatcgtatttatggtccattaggaaaagggattgacgtattagctgtt
ttagctacctctacaggggttgctacaacattcggattaagtgcgttgcaaattaccggg
ggattatctcacttaacaggtacgattccgaataatcctgcaactcaacttaccgttata
gctattgtgacagtactatttattttttcagctgcaacaggtgttaataaaggcatacga
attttaagtacgatcaacttaactgtcgcagggctattacttgtttttgtgattattttt
ggaccaacgctgtttattgcggaaagtgtcgtatcgacaataggcggatatatcgccaat
gtcacacaaatgagtcttgacttaaatccatttggtgacggagaatggctcgggatgtat
acgatctttttctgggcttggcacatttcgtgggcaccatttatgggtatttttatcgcc
cgtatctcacgtggaagaacgattcgcgaatttgttgctggggtgcttatcgttccttca
ttattagcggtcatttggtttacggcctttggtgggaccgccttagacatgattatgggt
ggaaatgatcatatcgcaaaccttgtgttggaaaatgttgaggttgccctgtttgttaca
ctcaatgaactgccacttgggatgataatgagtggattagcggttattttaatcatcatt
ttctttatcacatcagcagactctgcatcgtatgtgttagccgctttatctagtgaaggt
agtcttgatccaaagctatgggtaaaagtcgtttggggctttctgatcgcttcaacagca
agtgtgttgttagtaagtggaggattatcaggactgcaaaccgcttcgattgtcgccgcg
ctcccctttgccattatcatggtcattatgatcttctcgttactcatgatgatgagtaga
gatacgagagcggaacagctatggacgcgacggaagcgcacgagaaaaataaagaaggaa
gttcatagcgaaatgtacgatagagtaaaagacaatatgctcgatgacatgaaagaggac
gtttacgaggaaattaaggaagaagtatacgaacaagtgaaagaagaagtatacgacgac
attaaagaagaagtgtatgaagagtttaaggaaaaaatttatgatgatttacgcgaagat
ttaagtgaacagctaaatggagagttggaagaaagaatggacgactcggacgataagaaa
aaggagtag

DBGET integrated database retrieval system