KEGG   Bacillus cellulosilyticus: Bcell_1812Help
Entry
Bcell_1812        CDS       T01389                                 

Definition
(GenBank) Manganese/iron superoxide dismutase-like protein
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bco  Bacillus cellulosilyticus
Brite
Enzymes [BR:bco01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Bcell_1812
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N ATG16 PriC
Motif
Other DBs
NCBI-ProteinID: ADU30074
UniProt: E6TYM4
Position
1999738..2000610
Genome map
AA seq 290 aa AA seqDB search
MLDVNDYIEKLKEWLNDFEEQLHQSDGLSENFVDEVKGLQNKLSREEDHGKLGKIQYEAE
QLYDRYINSRAVESRNENDGESKRVAIGEHTLPRLNYQYHDLEPYIARRIMELHHKKHHQ
SYVDGLNKAEKELQRQRERNHFELVKHWERELAFHGAGHYLHTLFWKVMTPKGGGQPNGA
LLKQFVLDFGSFEAFKAHFSEAAKNVEGSGWAILVWSPRPGRLEVLTAEKHQNLTQWDVI
PLLPLDVWEHAYYLQYENKREDYISNWWKVINWPYVQQRFNEVRNNVSIV
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgttggatgtaaatgactatattgaaaagttaaaggaatggctaaatgactttgaagag
caattgcatcaatcagatggcttaagtgagaattttgtggatgaggtgaaaggtctccaa
aataagttaagtcgtgaagaagaccatggaaagcttggtaaaattcaatatgaagcagaa
caactttatgacaggtatattaatagcagagccgttgaatcgcgtaatgaaaacgatggt
gagagtaagagagtagccattggagaacatactttgccaagattaaactatcaatatcat
gatttggagccatacattgccagaagaattatggagctacaccataaaaaacatcaccaa
tcatatgtagatggattgaataaggcagaaaaagagttgcaaaggcaaagggaaaggaat
cattttgaactcgtaaaacattgggaacgcgaactagcctttcacggagcaggacactat
ttacacactcttttttggaaagtgatgacaccaaagggcggtggacaacctaatggtgct
ttgctaaagcagtttgttcttgattttggtagctttgaagcattcaaagctcacttctca
gaagcagcaaaaaatgttgaaggaagtggatgggcaattttggtctggtcaccacggcca
ggtcggctagaagttttaacagctgaaaagcatcaaaatttaacgcaatgggacgttatt
cctttgttacctttagatgtatgggagcacgcatattatttacaatatgaaaataagaga
gaagactatattagtaattggtggaaagtgataaattggccttatgtgcaacaaaggttt
aatgaggtgagaaacaacgtatcgattgtctaa

DBGET integrated database retrieval system