KEGG   Bacillus cellulosilyticus: Bcell_1879Help
Entry
Bcell_1879        CDS       T01389                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
K01817  phosphoribosylanthranilate isomerase [EC:5.3.1.24]
Organism
bco  Bacillus cellulosilyticus
Pathway
bco00260  Glycine, serine and threonine metabolism
bco00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bco01100  Metabolic pathways
bco01110  Biosynthesis of secondary metabolites
bco01130  Biosynthesis of antibiotics
bco01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bco00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bcell_1879
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bcell_1879
Enzymes [BR:bco01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Bcell_1879
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     Bcell_1879
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP PRAI
Motif
Other DBs
NCBI-ProteinID: ADU30141
UniProt: E6TZG7
Position
2057944..2059779
Genome map
AA seq 611 aa AA seqDB search
MTTLLKFCGITNFKDYDKAVESGVDYIGVIFAKSKRQVKAEDVKQWTLRKPLQSHQRLVG
VFVNERESVIKKIATTCNLDIVQCHGTEKRDEISKLKENIQAQIFKTIHHHEKALLTMRE
YKGTVDGFVIDTKTDAEWGGTGIRFDWNSIPKYQFEALSQRVPCMIAGGVKVDNIDELMT
YNPIGIDVSSGIETNGIKDERKMAKMASKVKNNYAAPDKLGRFGDFGGRYVPETLMYALE
QLESAFDEAVQDEHFFAELHNEWEKYSGRPTPLTVAERLSKTLGGASIYLKREDLNHTGA
HKINNAIAQAILAKRMGKQQIIAETGAGQHGVAAATVAARFGLTCKVFMGEEDMKRQELN
VFRMKLLGAEVIKVTSGGKTLKDATNEAIRHWVSHVNDTFYLIGSAVGPHPYPKMVREFQ
SVIGRESRRQFLTETGALPDEVIACVGGGSNAIGMFYPFINDEQVVLTGVEAAGKGVDTE
EHAATLTKGVKGVLHGSLSYLLQDDFGNITEPYSISAGLDYPGIGPEHAYLRDIGRVSYE
SITDKEAIEALQTLCQLEGILPAIESAHALAQAFKRAKELSEGKTILVCLSGRGDKDVHT
IQGVLEGDNNE
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgactacacttcttaagttttgcggaattacaaattttaaagattatgacaaagcagtt
gaaagtggtgtagattatataggtgtaatttttgcaaagagtaaaagacaagtgaaggct
gaggatgtgaaacaatggacattgaggaaacctttacagtctcatcaaagactcgtaggg
gtttttgttaatgagcgagaaagtgtcataaagaagatcgcgacaacgtgtaatctagat
atagttcaatgtcatggaacggaaaaacgagatgaaataagcaaattaaaagaaaacata
caagcacaaattttcaaaactattcaccatcatgaaaaggcgttgttgacgatgagggag
tataaaggcactgtagacggctttgttattgatacgaaaacagatgctgaatggggagga
actgggatacgttttgattggaatagtattccgaagtatcaattcgaagcactgagtcaa
cgagtgccttgtatgattgctggtggagtgaaagtggataatattgatgaactaatgact
tataatcctatcggtatcgatgtttcatcagggattgaaacaaacgggataaaagacgaa
aggaagatggcaaaaatggcttctaaagtaaaaaacaactatgcggcaccagataaatta
gggagatttggagactttggtggaaggtatgtaccggaaaccttaatgtatgcacttgaa
cagttagaatcagcctttgatgaggcggtacaggatgaacatttctttgctgagttacac
aatgaatgggagaaatattctgggagaccaacgcctttaacggtagcagaaaggctatca
aaaacattagggggagcttcaatatatttaaagagagaagacttaaaccatacaggtgct
cataaaatcaacaacgctattgctcaagcaatccttgcaaaacgaatgggcaaacagcaa
attattgctgaaactggagctggccaacatggagttgctgctgcgactgtagctgcaagg
tttggacttacatgtaaagtgtttatgggtgaagaggatatgaaacgtcaggaattaaat
gtctttcgcatgaagctgcttggtgcagaagtaattaaagtaacgagtggtggaaaaaca
ttaaaggatgctacaaatgaagcgatcagacattgggtatcacacgtaaatgatacattt
tatttaattgggtctgcagttggacctcatccatatcctaaaatggtaagggagttccaa
tctgttatcgggcgtgaaagtagaagacagtttcttactgaaacaggagcactaccagat
gaggttattgcttgtgtcggtggtggaagtaatgcaattgggatgttttacccgtttatc
aatgatgagcaagttgttttaacaggagtagaagctgcaggaaaaggagtagatacagaa
gaacacgccgctactttaacaaaaggcgtgaaaggtgtattgcacggctcactatcttat
ttattacaagacgactttggaaacattacagaaccatattctatttcagcaggtctagac
tatcctggcattggaccagagcacgcttatttaagagatatcggcagagtttcatatgaa
tctattactgataaggaagcaatagaagcccttcaaacactatgtcaactagagggtatt
cttcctgctattgaatctgcacatgcgttagcccaagcctttaaaagggcaaaagagcta
tctgaaggtaaaacaatattagtttgtctatctggcaggggtgataaggacgttcacaca
attcaaggtgtattggagggggataataatgaatag

DBGET integrated database retrieval system