KEGG   Bacillus cellulosilyticus: Bcell_3125Help
Entry
Bcell_3125        CDS       T01389                                 

Definition
(GenBank) glutamate-1-semialdehyde-2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
bco  Bacillus cellulosilyticus
Pathway
bco00860  Porphyrin and chlorophyll metabolism
bco01100  Metabolic pathways
bco01110  Biosynthesis of secondary metabolites
bco01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bco00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Bcell_3125
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bco01007]
    Bcell_3125
Enzymes [BR:bco01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     Bcell_3125
Amino acid related enzymes [BR:bco01007]
 Aminotransferase (transaminase)
  Class III
   Bcell_3125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: ADU31368
UniProt: E6TZR2
Position
complement(3322118..3323401)
Genome map
AA seq 427 aa AA seqDB search
MNRNKSIEAFKHAKKVMPGGVNSPVRAFKSVNLDPVFMEKGKGSTIWDIDGNEYIDYVLS
WGPLVLGHADDQVVEALKAVTEKGTSFGAPSEIETTLAELVVERVPSIEVVRMVNSGTEA
TMSALRLARGYTGRNKIVKFEGCYHGHGDSLLIKAGSGVATLGLPDSPGVPESVAQNTLT
VPYNDLESLKLAFSEFGDDIAAVILEPVAGNMGVVPPEEGFLEGVRKITEDNGTLMIFDE
VMTGFRVGYECAQGKFGVTPDLTCLGKVIGGGLPVGAYGGKREIMEKIAPAGPIYQAGTL
SGNPLAMTAGYETLRQLTPESYEEFERLGKRLAEGLSAAAKNYGIPHHINRAGSMVGFFF
TNEKVTNYEKASSSDLSMFTQYFKLMLDQGISIPPSQFEGMFLSTKHTDEDIDRTIEAAK
QAFAKIK
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgaaataagtcaatagaagcatttaaacatgcaaagaaggttatgccaggtgga
gtcaatagtcctgtacgtgcttttaaatcagtaaacttagaccctgtttttatggaaaaa
ggtaaagggtcaaccatatgggacattgatggaaatgagtatattgattacgtgctttct
tggggtccgctagtattaggtcatgctgatgatcaagtcgtagaagcattaaaagctgta
acggaaaaaggaactagcttcggtgcccctagtgaaatcgaaacgacgttagctgagcta
gttgtagaacgtgtaccttcaattgaagttgttcgaatggttaactcaggaacagaggct
acaatgagtgccctacgattagcaagaggctacactggccgtaataaaattgtgaaattt
gaaggctgctaccacggtcatggagattctttacttattaaagctggttccggtgtagca
acgttagggttacccgatagtcctggtgtacctgaatccgttgcacaaaatacgttaaca
gtaccatataacgacctagaaagcttaaaattagcatttagtgagtttggggacgatatc
gctgcagtaatattagagccagtagcaggaaacatgggcgttgtccctccagaggaagga
ttcttagaaggtgtccgcaaaataactgaagataatggaactctaatgatatttgacgag
gttatgacaggtttccgtgtaggctacgaatgtgcccaagggaagtttggtgttacacca
gatttaacttgtttaggaaaagttattggtggtggattaccagtaggtgcttacggtggg
aagcgtgaaataatggaaaaaattgctccagctggtccaatctatcaagcaggtacgttg
tcaggaaacccattagcgatgacagctggttatgaaacgctccgtcagcttacgcctgaa
agctatgaagaatttgagcgattaggaaaacgtcttgctgaaggcttgtcagcagctgca
aagaactatggtattccacaccatatcaatcgtgccggatcaatggtaggctttttcttt
actaacgaaaaagtaactaattatgaaaaagcatcttcatcagatttatctatgttcaca
caatacttcaagttaatgctagaccaaggcatatctataccgccttctcaattcgaagga
atgttcttatctacaaagcatactgatgaggatattgaccgcacaattgaagcggcaaag
caggcatttgcaaaaataaaataa

DBGET integrated database retrieval system