KEGG   Bacillus cellulosilyticus: Bcell_3504Help
Entry
Bcell_3504        CDS       T01389                                 

Definition
(GenBank) LPXTG-motif cell wall anchor domain protein
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
bco  Bacillus cellulosilyticus
Pathway
bco00511  Other glycan degradation
bco00600  Sphingolipid metabolism
bco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bco00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Bcell_3504
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Bcell_3504
Enzymes [BR:bco01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Bcell_3504
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_30 CBM_6 Glyco_hydro_30C Glyco_hydr_30_2 fn3 CBM_4_9 Gram_pos_anchor DUF4992 Spc7 TMPIT DUF4959 V_ATPase_I DUF4763 ATG16 FapA TBPIP DUF1664 DASH_Spc19 SlyX
Motif
Other DBs
NCBI-ProteinID: ADU31746
UniProt: E6TQX1
Position
complement(3745403..3749281)
Genome map
AA seq 1292 aa AA seqDB search
MKNKVKHLSIILATVLLVVSPFSTSFMNTTFANDTDIEVEAWLTQADESKKLEKVDKIYF
QDDSLTPSKSTTIDVNEHTTYQEMDGFGAALSGSSAYLINRLPAEERTELLSELFGNEEE
DANFSFLRVTMGASDFNTKRFTYNDMPEGETDPDLEHFTIEEDADVIAVLQEIVDIQEDI
KIMASPWSAPAWMKEPETLNGGRLKEEHYDTYANYFVKFIEAYQEEGIDVYAVTVQNEPH
HESGDGGSEYGYPTMRMTASAQAEFVKNHLGPAFEENNIDTKIIIWDHNWNEPEYPLEVL
EDDEVKEYVAGTAFHCYAGDFRNQSLINNEHPDKGIWFTECSGGDWATDFGENLAWNMEN
IMIGSIRNWSKSVLLWNLALDENAGPITPPENEDDDRITGGCSDCRGVVTIDSETNEITR
NEEYYILGHASKFVQPGAERIESSDLGTNSIQNVAFMNPDGSKALIAMNNTNAAREFKVR
WGSQSFIYELDAGSVITFTWDGEQSGSTIVSGLSRMQAENFSEASTELNIENTDDIGGGS
FVGGIDTDDYIRFENVDLDSEINSVLTRVATAWDSGIEFRVGSPDGHLIGTVDISNTGGW
LDWKTISAPVDVTGVDGINDLYLVFQGPVNVNWFQFSTDFFQDTLNYVNNGSFETGDMKH
WSGWNPGGQDAAHNVTISEARTGSYKVDHWLGDDYMQSTYQTIKVPNGTYTYSVWVRSSG
DQEELRLEAKNYGGDDIHKEIGSNGIGSWTQFSIENIHVTNGQVEIGVFSNANGGNWANF
DDFSLHRVTTKAPTSATSDIEAPGGIAGDVLSASDIELSWNSVEGAVGYKIYRSLTVQDQ
TSEYLERTITSDTSFVDYGLTGDTTYNYVVTAYNNEGESLPSQSITLTTEEGVDSIAPAA
PTNFSGEPRSGAVKLYWDNNIEFDFLKYNIYQDGERVASVSPVTETSIIIDALQGGHEYS
FTISAEDIFGNESEQSDPLVLSPTVSGFVVDLPNMSFEAGDLTDWEGDGSVDDDFPHSGE
YKLTHSVEDGELYTYRVEDVPNGEYAVSVWVRSGGLETLQLQVRNYGGDVLTQDMFSNSW
DAWTPFTIENIEVTNGQIEFGVFSQAGESHGWAGIDDFELISYSEVEVPGDEEPPSEEEP
STPPTDNELLERIVELEALLADLTQRLNELKSENDVSDVQQRIEVLELELLELSQLYEDL
GYELSELEERLSELQEELNQLKEVYDEIDSPDSEEVEKEVDAVDESSKEKEKQGEELPDT
ATNMYSSLLIGFILLSIGGVIFFVTKKRYRAE
NT seq 3879 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaataaagtaaagcatttatcgatcattttagcgactgtattattagttgtttct
ccattttctacttcttttatgaatacaacatttgcaaatgacacagatatagaagttgaa
gcatggctaacgcaagcagatgaatctaaaaaactagagaaagtagataaaatatatttt
caagatgatagtcttactccaagtaaatctacgacaatcgatgtcaatgaacacacaacc
taccaagagatggacggatttggcgcagccttatctggctcgtcagcctacttaatcaat
cgactaccagcagaagaacgtacagaattgttaagtgaactttttggaaatgaagaagag
gatgcaaactttagttttttgagagtgacaatgggtgcatctgactttaacacgaaaaga
tttacgtataacgatatgccagaaggtgaaacagatccagatttagagcacttcacgata
gaagaggatgcagatgttatcgctgttctccaagagatagtggatattcaagaagatatt
aaaataatggctagtccatggagtgcaccagcctggatgaaggagccagaaacattaaat
ggcggccgcttgaaagaagagcattatgacacatacgctaattattttgtgaaatttata
gaggcttatcaagaagaaggtattgatgtatacgcggttactgtacaaaatgaaccacat
catgagtctggtgacggtggctctgaatacggttatccaacaatgagaatgactgcaagt
gcgcaagctgagtttgttaaaaatcatttaggacctgcgttcgaagagaacaatattgat
acgaaaataatcatttgggaccataactggaatgagcctgagtatcctttagaagttctc
gaagatgatgaggtgaaagagtacgttgcaggtacggcctttcactgttatgcaggggat
tttagaaaccaatcattaatcaacaatgagcacccggataaaggaatctggtttacagaa
tgctcaggtggagattgggcaacagattttggagaaaacctagcatggaatatggaaaac
attatgattggatcaattcgtaactggagcaagagcgtcttgctttggaacttagcattg
gatgaaaacgctggtccaattacaccaccagaaaatgaagatgacgacagaattacaggt
ggatgttccgattgtcgaggtgttgtaacgatagactctgaaacgaatgagattacgaga
aatgaagaatactatattctagggcatgcaagcaaatttgttcaaccaggtgctgaaaga
atagaatcatctgatctaggaacaaatagtattcaaaatgtcgcatttatgaatccagat
ggatcgaaagcattaatagcaatgaacaatacgaatgccgcaagagaatttaaagtacgt
tggggatcacaatcatttatttatgaattagatgctggttctgtcatcacatttacttgg
gatggggagcaaagtggatcaacgattgtttccggattatctagaatgcaagcagagaat
ttttcagaagcatcgacggaattgaatatcgaaaacacggatgatattggtggtggatcg
ttcgttggtggtatcgatacagacgattacattcgatttgaaaacgttgatttagatagt
gaaattaatagtgtactaactcgtgttgctactgcgtgggattcaggcattgaatttcgt
gttggttcaccggatggtcacttaattggaactgttgatattagtaacactggtggttgg
ctcgattggaaaacaatctctgcaccggttgatgtgacaggagttgatggaataaacgat
ttatatttagtattccaggggcctgtaaatgtaaactggttccagttttcaacagacttt
ttccaagatacattgaactatgtgaataacggtagttttgagacaggagatatgaagcat
tggtctggctggaacccaggtggacaagatgccgcccataatgtaacgatttctgaggcg
cgtactggttcatacaaggttgatcactggcttggtgacgattatatgcaaagtacttac
caaactatcaaagtgccaaacggaacttacacgtattctgtatgggtacgttcgagtggt
gatcaagaagagctaagattagaagcgaaaaactatggtggagatgacattcataaagag
attggttcaaacggcattggttcttggacacagttttctatcgaaaacattcatgtaacg
aatgggcaagtagagataggtgtattctcaaatgcaaacggtgggaattgggcaaacttt
gatgattttagcctacatcgtgttacaacgaaagcaccaactagtgccactagtgatatc
gaagcaccaggaggaatagctggagacgtgctgagcgcttctgatattgaattgagttgg
aatagcgttgaaggcgcagttggatataaaatttatcgttctcttactgtccaagatcaa
acatccgaatatttagaacgtacaattacttcagacacaagttttgttgactatggacta
acaggagatacaacttacaattacgtcgtaactgcttataacaatgagggagaatcgtta
ccatcacagtctattacgttaacgacagaagaaggggtggattcaatcgctccagcagca
cctactaatttttctggagagcctagaagtggtgcagtaaaactatactgggacaacaat
atcgagttcgactttttaaagtataatatttatcaagatggcgaaagagtcgcatcagtt
agcccagtaacagaaacttcaatcatcattgatgcacttcaaggcggacatgaatattcg
tttacaatcagtgctgaagacatatttggtaacgagtctgaacaatctgatccacttgtt
ttatcgccgactgttagtggatttgttgtcgatctaccgaatatgagctttgaggctgga
gatttaacagattgggaaggagatggatcagttgatgatgacttccctcacagcggagaa
tacaaattaacacatagtgtagaagatggtgagttatacacttatcgcgttgaagatgta
ccgaatggcgaatatgctgtttctgtgtgggtcagatctggcggacttgaaacgcttcag
cttcaagtacgcaattatggtggagatgtgttaacacaagatatgttctcaaattcatgg
gatgcttggacaccatttacaattgaaaacatagaagtgacaaatggtcagatagaattt
ggcgtattctcacaagcgggagaatctcatggttgggcaggtattgatgactttgaatta
atttcttattcagaggtagaagtacctggtgatgaagaacctcctagtgaagaagagcca
tcaacaccacctacagacaatgagttgttggagagaatagttgaattagaggcattacta
gcagaccttacacaaagattaaacgaattaaaatctgagaatgatgtaagtgatgtacag
caacgaatcgaagtgttagagttagaactacttgagctctcgcagctttatgaagactta
ggttatgaattgtctgaattagaagaacgactcagtgaattgcaggaagagttaaatcaa
ctgaaagaagtatacgatgagatagactctcctgactccgaagaagtggaaaaagaagta
gatgctgtcgatgaatcttccaaggagaaggaaaaacaaggagaggaattacctgatacg
gcaacgaatatgtattctagtttgttaataggatttatattactctctattggtggcgtt
atcttcttcgtaactaaaaaaagatatcgcgctgaatag

DBGET integrated database retrieval system