KEGG   Bacillus cellulosilyticus: Bcell_3518Help
Entry
Bcell_3518        CDS       T01389                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bco  Bacillus cellulosilyticus
Pathway
bco00010  Glycolysis / Gluconeogenesis
bco00051  Fructose and mannose metabolism
bco00562  Inositol phosphate metabolism
bco01100  Metabolic pathways
bco01110  Biosynthesis of secondary metabolites
bco01120  Microbial metabolism in diverse environments
bco01130  Biosynthesis of antibiotics
bco01200  Carbon metabolism
bco01230  Biosynthesis of amino acids
Module
bco_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bco_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bco00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcell_3518
   00051 Fructose and mannose metabolism
    Bcell_3518
   00562 Inositol phosphate metabolism
    Bcell_3518
Enzymes [BR:bco01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Bcell_3518
Exosome [BR:bco04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Bcell_3518
  Exosomal proteins of bladder cancer cells
   Bcell_3518
  Exosomal proteins of melanoma cells
   Bcell_3518
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADU31759
UniProt: E6TRC9
Position
complement(3766536..3767294)
Genome map
AA seq 252 aa AA seqDB search
MRKPIIAGNWKMNKTKGEALSFIEEVKSAVPSKDVVESVICAPDLFLDALVSATEGSDVE
VGAQNMHFEESGAFTGETSPVALKDLGVSYVVIGHSERREMFGETDESVNQKVHAAFNHG
LTPIVCVGETLEEREGNKTSEVVTTQVTAALKGLSEEQVKATVIAYEPIWAIGTGKTASS
EDANETCGVIRQVVKSIVSDSAAEAVRIQYGGSVKPANIGELLAQSDIDGALVGGASLEA
KSYLQLVEAGNE
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaccaatcattgcaggaaactggaaaatgaacaaaacgaaaggggaagcacta
agcttcatcgaagaagtaaagtccgctgtcccatcaaaagatgttgtagaatccgttatt
tgtgcaccagacttattcctagatgctttagtaagtgcaacagaaggctctgacgtagaa
gtcggtgctcaaaacatgcacttcgaggaaagtggagcatttactggagaaacaagtcca
gtagcacttaaagatttaggtgtaagctatgtcgttattggacattctgagcgacgtgaa
atgtttggtgaaacggatgagagtgtgaaccaaaaagtacatgctgcatttaaccacggg
ttaacaccgatcgtttgtgttggtgaaacgttagaagagcgtgaaggaaataaaacatct
gaagttgttactacacaagtaacagcagcacttaaaggtctatcagaagaacaagtaaag
gcaactgtaattgcttacgagccaatttgggcaatcggaactggtaaaacagcttcttct
gaagatgcaaatgaaacttgtggcgttatccgccaagttgtaaaaagcatcgtttctgac
tctgctgcggaagcagtacgaattcagtatggtggaagtgtaaagcctgctaacattggt
gaactacttgcacaatctgatattgacggtgcgctagttggtggcgcaagcttagaggca
aaatcttatcttcagttagtggaggcaggaaatgagtaa

DBGET integrated database retrieval system