KEGG   Bacillus cellulosilyticus: Bcell_4225Help
Entry
Bcell_4225        CDS       T01389                                 

Definition
(GenBank) transcriptional activator, TenA family
  KO
K03707  thiaminase (transcriptional activator TenA) [EC:3.5.99.2]
Organism
bco  Bacillus cellulosilyticus
Pathway
bco00730  Thiamine metabolism
bco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bco00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    Bcell_4225
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bco03000]
    Bcell_4225
Enzymes [BR:bco01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.2  aminopyrimidine aminohydrolase
     Bcell_4225
Transcription factors [BR:bco03000]
 Prokaryotic type
  Other transcription factors
   Others
    Bcell_4225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TENA_THI-4 Haem_oxygenas_2
Motif
Other DBs
NCBI-ProteinID: ADU32452
UniProt: E6TZ09
Position
4564800..4565474
Genome map
AA seq 224 aa AA seqDB search
MKFSERLHKKLQPIWRKNHAHPFVQGIGDGTLDKEKFRFFMIQDYLYLIDYAKLFAIGAV
KAKDVETMGKFANLLDSTLNEEMSLHREYGKKFGITPEEFEQAAPAPTTLAYTHYMLHVG
QNGTLADLVTALLPCMWSYWEIGKELNEIPGASEHEFYGEWIQMYSSEEFGQLAEWTINL
LDELTEGKTEDELAKLEEIFLNTTRFEYMFWDMSWNKQMWPTDE
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttagcgaacgtttacacaaaaagcttcagcctatttggcgtaaaaaccatgca
catcctttcgttcaaggaattggtgacggcacgcttgataaagaaaagtttcgttttttt
atgattcaagattatctttacctcattgactatgcaaagcttttcgcgattggtgctgtt
aaagcgaaggatgtagaaacaatgggcaaatttgctaacttgttagattcaacattaaat
gaagaaatgtcactacacagagagtacgggaaaaagtttggaattacgcctgaggaattt
gagcaagctgctccagcaccgacaactttagcatacacgcattacatgctacatgttgga
caaaacggtacacttgcagacctcgtaacagccttgcttccttgtatgtggagctactgg
gaaattggtaaagaattaaatgaaattcctggtgcaagtgagcatgagttttatggcgag
tggatccaaatgtatagctccgaggaattcggtcagttagccgaatggactatcaattta
cttgatgaactaacggaaggaaaaacagaggacgagttagcaaagcttgaagaaatcttt
ttaaatacaactcgttttgaatatatgttctgggatatgtcctggaataagcaaatgtgg
ccgacagatgagtaa

DBGET integrated database retrieval system