KEGG   Bacillus coagulans DSM 1 = ATCC 7050: BF29_1399Help
Entry
BF29_1399         CDS       T03712                                 

Definition
(GenBank) phosphate transporter family protein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
bcoa  Bacillus coagulans DSM 1 = ATCC 7050
Brite
KEGG Orthology (KO) [BR:bcoa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BF29_1399
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AJH78049
UniProt: A0A0B5X4X6
Position
1354333..1355331
Genome map
AA seq 332 aa AA seqDB search
MDSILVLTVLIVIFAFGFDFINGFHDTANAIATAVSTKALKPRHAIIMAALMNFLGAISF
TGVAETITESIVNPFTLANGQIVILSSLISAIIWNLITWYFGIPSSSSHAIIGSIAGAAI
ASSGFHVIEYRGFISIIEALLLSPILAFTIGFTVYSIFKVAFQNFNLAKTNRHFRLIQIF
TAALQSFSHGTNDAQKSMGIITMALIANHYIADNHIPFWVQVGCAAAMGLGTAMGGWRII
KTVGGNIMKIRPINGVAADLSSAFIIFGATFIHLPVSTTHVISSSILGVGSAHRIKGVKW
DTAKRMVITWVITLPISAVLSGAIYHIVSLFW
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggatagcattttagtattaactgtcttaattgtgatttttgcatttggattcgatttc
atcaatggattccatgacacggcgaacgcgattgcaacggccgtttcgacaaaagcatta
aaaccccggcatgcgattataatggccgcgcttatgaattttctcggcgccatttcattt
acaggtgttgcggagacgattacagaaagtattgtgaacccgttcacccttgcaaacggg
cagattgtcattttgtcctcattgatttcagcgattatttggaatttgattacatggtat
ttcggcattccaagcagttcttcccatgcgattatcggatccattgccggcgcggcgatc
gcctcgtcaggatttcatgtgatcgaataccgtggttttatcagcattatcgaagcctta
cttttatccccgatcctcgcttttacgatcggttttacggtttacagcatttttaaagtt
gcattccagaattttaatcttgcaaaaacaaaccggcacttccggctgattcaaattttc
accgccgccctccagtctttctcccatgggacaaacgatgcccagaaatcgatggggatt
atcacaatggctttgattgccaaccattatatcgctgataaccatattccgttctgggtc
caggtcggttgtgcggcggcaatggggcttggcactgcgatgggcggctggcggatcatt
aaaacggttggcggcaatattatgaagatccggccgattaacggggttgcagccgacctg
agttcagctttcatcatttttggcgcgacatttatccacttgccggtcagcaccacccat
gtcatttcttcctccattctcggggttggttcggcccaccggattaaaggggtcaagtgg
gatactgcaaaaagaatggtgatcacttgggtcattacccttccaatttcagccgttttg
tccggtgcgatttatcatattgtaagccttttttggtaa

DBGET integrated database retrieval system