KEGG   Bacillus coagulans DSM 1 = ATCC 7050: BF29_1719Help
Entry
BF29_1719         CDS       T03712                                 

Definition
(GenBank) zinc-binding dehydrogenase family protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
bcoa  Bacillus coagulans DSM 1 = ATCC 7050
Pathway
bcoa00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:bcoa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BF29_1719
Enzymes [BR:bcoa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     BF29_1719
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     BF29_1719
    1.1.1.-  
     BF29_1719
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: AJH77112
UniProt: A0A0B5WYY3
Position
complement(1672087..1672806)
Genome map
AA seq 239 aa AA seqDB search
MREYRAAFGASETVEGVSYFHENNIYRVPDSLSLEEAALVEPSAVAVQAVKDSGLRFGDT
VAIFGAGPIGLLTIVAARAAGASRIVVADLSQPRLDLAKKAGATDIINSGEKDAVQTIRD
LVPGGVDVSFEVAGVAPTFKQALDATKARGIVDVISIFARPIEWNPMQLTNTGVSVTASI
VYTKKTFQQTINLIASGQLKPQDVVTSHIQLEEIVEKGFEALTKDKSQAKILVKLSGEK
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgcgagaatatcgcgcggcttttggtgctagcgaaacagtagagggcgtatcatatttt
cacgaaaataatatttaccgcgtgccggattccttgtctttggaggaagctgcattagtt
gagcctagcgcggttgctgtacaggctgtgaaagatagtggtttaagatttggcgatacg
gttgcgatttttggtgcaggcccgatcggattattgaccattgttgcagcacgtgcggca
ggtgcaagccggattgtcgtggcagatttgtcgcaacctcgtctggacctggcgaaaaaa
gcaggcgcgaccgacattattaactccggggaaaaagatgccgtccaaaccatccgtgat
cttgttccgggcggcgtagatgtatcctttgaagtggccggcgttgctccgactttcaaa
caagcacttgatgcaacgaaagcacgcgggattgtcgatgtcatttctatctttgcacgc
ccgatagaatggaacccgatgcagttaacgaatacaggtgttagcgttacagcatcgatt
gtttacacgaagaaaacattccaacaaacgattaacctgattgcatccggccaattgaaa
ccgcaagacgtcgttaccagccatatccaattggaagaaatcgttgaaaaaggcttcgaa
gctttgacaaaagacaaatcccaggcgaaaattttggttaaattgagcggggagaaataa

DBGET integrated database retrieval system