KEGG   Bacillus coagulans DSM 1 = ATCC 7050: BF29_2075Help
Entry
BF29_2075         CDS       T03712                                 

Gene name
glpX
Definition
(GenBank) fructose-1,6-bisphosphatase, class II
  KO
K02446  fructose-1,6-bisphosphatase II [EC:3.1.3.11]
Organism
bcoa  Bacillus coagulans DSM 1 = ATCC 7050
Pathway
bcoa00010  Glycolysis / Gluconeogenesis
bcoa00030  Pentose phosphate pathway
bcoa00051  Fructose and mannose metabolism
bcoa00680  Methane metabolism
bcoa01100  Metabolic pathways
bcoa01110  Biosynthesis of secondary metabolites
bcoa01120  Microbial metabolism in diverse environments
bcoa01130  Biosynthesis of antibiotics
bcoa01200  Carbon metabolism
Module
bcoa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bcoa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BF29_2075 (glpX)
   00030 Pentose phosphate pathway
    BF29_2075 (glpX)
   00051 Fructose and mannose metabolism
    BF29_2075 (glpX)
  09102 Energy metabolism
   00680 Methane metabolism
    BF29_2075 (glpX)
Enzymes [BR:bcoa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     BF29_2075 (glpX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_glpX
Motif
Other DBs
NCBI-ProteinID: AJH79648
UniProt: A0A0B5X6S7
Position
complement(2009595..2010542)
Genome map
AA seq 315 aa AA seqDB search
MELVRVTEAAALASARWMGRGLKDEADDAATSAMRDVFDTIPMKGTVVIGEGEMDEAPML
YIGEKLGNGYGPRVDIAVDPLEGTNILASGGWNALSVLAIADHGHLLHAPDMYMDKIAVG
PEAVGMIDINAPIIDNLKAVAKAKNKDIEDVVATVLNRPRHEEIIAQLRAAGARIKLIND
GDVAAAINTAFDHTGVDILFGSGGAPEGVISAVALKCLGGEIQGRLLPQNDAEQERCLSM
GVDINKVLMMDDLVSGDDAIFAATGVTDGELLRGVQFKGQYGSTHSVVMRAKSGTVRFIE
GQHSLKKKPNLVIKA
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggaattggtccgtgtcacggaagcagcagcacttgcatccgcaagatggatggggcgc
ggattgaaagatgaagcggatgatgcggcaacgtccgcgatgcgtgatgtgttcgacacc
attccgatgaaaggcactgtcgtcattggcgaaggggaaatggatgaagcgccgatgctg
tatatcggggaaaaactcgggaacggatacggcccgcgcgttgacattgcagttgacccg
ctggaaggaacgaatatcctggcatccggcggctggaatgcgctcagtgtgctggcgata
gcagatcacggacatttgctccatgcgccggatatgtacatggataaaattgctgtcggc
cctgaagcagtcggcatgattgatattaatgcaccgattatcgataatttaaaggctgtg
gcaaaggcgaaaaataaagatatcgaggatgtggtggcaacagttctgaaccgtccgcgc
catgaagaaattattgcgcagctccgtgctgcaggcgcccggatcaaactgatcaatgac
ggggatgtggcagctgccattaacacggcattcgaccataccggtgtagatattttgttc
ggatcgggcggcgcgccggaaggggttatttcagcagttgcgctgaaatgcctcggcggc
gagatccagggacgcctcctgccgcaaaacgacgcggagcaagaacgctgcctgagcatg
ggggttgacatcaataaagtgctgatgatggacgaccttgtgagcggggatgacgccatt
tttgctgcgaccggcgtaaccgacggggaacttttgcgcggtgtccaatttaagggccag
tacggatccacccattctgtcgtcatgcgtgcaaagtcggggacggtccgctttattgaa
gggcagcacagtctgaagaaaaagccgaaccttgtgatcaaagcgtaa

DBGET integrated database retrieval system