KEGG   Bacillus coagulans DSM 1 = ATCC 7050: BF29_2666Help
Entry
BF29_2666         CDS       T03712                                 

Gene name
thlA
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bcoa  Bacillus coagulans DSM 1 = ATCC 7050
Pathway
bcoa00071  Fatty acid degradation
bcoa00072  Synthesis and degradation of ketone bodies
bcoa00280  Valine, leucine and isoleucine degradation
bcoa00310  Lysine degradation
bcoa00362  Benzoate degradation
bcoa00380  Tryptophan metabolism
bcoa00620  Pyruvate metabolism
bcoa00630  Glyoxylate and dicarboxylate metabolism
bcoa00640  Propanoate metabolism
bcoa00650  Butanoate metabolism
bcoa00900  Terpenoid backbone biosynthesis
bcoa01100  Metabolic pathways
bcoa01110  Biosynthesis of secondary metabolites
bcoa01120  Microbial metabolism in diverse environments
bcoa01130  Biosynthesis of antibiotics
bcoa01200  Carbon metabolism
bcoa01212  Fatty acid metabolism
bcoa02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bcoa00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BF29_2666 (thlA)
   00630 Glyoxylate and dicarboxylate metabolism
    BF29_2666 (thlA)
   00640 Propanoate metabolism
    BF29_2666 (thlA)
   00650 Butanoate metabolism
    BF29_2666 (thlA)
  Lipid metabolism
   00071 Fatty acid degradation
    BF29_2666 (thlA)
   00072 Synthesis and degradation of ketone bodies
    BF29_2666 (thlA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BF29_2666 (thlA)
   00310 Lysine degradation
    BF29_2666 (thlA)
   00380 Tryptophan metabolism
    BF29_2666 (thlA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BF29_2666 (thlA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BF29_2666 (thlA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BF29_2666 (thlA)
Enzymes [BR:bcoa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BF29_2666 (thlA)
Exosome [BR:bcoa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BF29_2666 (thlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III SpoVAD ACP_syn_III_C DUF2802
Motif
Other DBs
NCBI-ProteinID: AJH77165
UniProt: A0A0B5WMG4
Position
2534756..2535934
Genome map
AA seq 392 aa AA seqDB search
MHEVAIISAVRTPIGKFGGSLKDISAVELGAIAAEEAIRRAGVSAREVHYAVFGNVLSAG
LGQNPARQMAVRAGIPYEVPAVTVNEVCGSGLKAVLLAAQMIQLGEAKITVAGGAENMSR
APYLAEQARWGHKLGNMAMADSMLRDGLTDAFEGIHMGLTAENVAAKFGISREEQDRFAL
QSQQKAAQAQKAGRFKDEIVPVKIKQRRSEMLFTEDEHVRPETTLDGLAKLKPAFLEDGT
VTAGNASGINDGAAAVVLMEKSLADEKKIPYLGVIKGYAEAGTDPSIMGYAPYYAIQKLL
EKTGVSLEEVDLIELNEAFASQSLAVIRDLGLDPEKVNVNGGAIALGHPIGASGARILVS
LLYEMEKRNVRTGLASLCVGGGLGISMLVGRT
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgcatgaagttgcgattatcagcgccgtccggaccccgatcgggaaattcggcggcagt
ttaaaagatatatctgctgtggaactgggcgcgattgccgcagaagaagcgatccggcgc
gccggcgtttctgcacgggaggtccattatgccgtttttggcaatgttctttcggctggc
ctcggccaaaacccggcccggcaaatggcagtcagagccggcattccgtatgaagtgcct
gccgtcaccgtgaatgaagtgtgcggctccggattgaaagctgtgctgcttgctgcccag
atgattcagcttggcgaggcgaaaataacggttgctggcggggcggaaaacatgtcgcgt
gcgccttatcttgcagagcaggcacgctggggccataagcttggcaatatggcgatggca
gacagcatgctgcgcgacggcctgacggatgcatttgaaggcattcatatgggtttgacg
gcggaaaatgtggcggcaaaattcggcatttcccgcgaagaacaggaccgttttgcgctt
caatcccagcaaaaagccgcgcaggcgcaaaaggccggccgtttcaaagacgaaattgtg
ccggtaaaaataaaacagagaagaagcgagatgctgtttaccgaggatgagcatgtccgc
cccgaaacgacgcttgatgggctcgcgaagctgaaacccgcttttctcgaagatggcact
gtcacagcagggaatgcttcggggatcaatgacggcgcagctgctgtagttttaatggaa
aaatcacttgcggatgaaaaaaagattccttatctcggggtcatcaaagggtatgcagaa
gcaggaacggacccttccatcatggggtatgccccttattacgcaattcaaaagctgctt
gaaaagaccggtgtatccctggaagaagtggatttaatcgagctgaacgaagcttttgcc
tcccaaagccttgccgttatcagggatttggggcttgatccggaaaaagtcaatgttaac
gggggcgcgattgcactggggcatccgatcggggcatccggcgcaagaattctcgtttca
cttttatatgaaatggaaaaaagaaatgtgcgcaccggcctcgcctcgctttgtgtcggt
ggcggccttggcatttcgatgttggtcgggcgcacgtga

DBGET integrated database retrieval system