KEGG   Bacillus coagulans DSM 1 = ATCC 7050: BF29_3415Help
Entry
BF29_3415         CDS       T03712                                 

Gene name
ackA
Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
bcoa  Bacillus coagulans DSM 1 = ATCC 7050
Pathway
bcoa00430  Taurine and hypotaurine metabolism
bcoa00620  Pyruvate metabolism
bcoa00640  Propanoate metabolism
bcoa00680  Methane metabolism
bcoa01100  Metabolic pathways
bcoa01120  Microbial metabolism in diverse environments
bcoa01200  Carbon metabolism
Module
bcoa_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:bcoa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BF29_3415 (ackA)
   00640 Propanoate metabolism
    BF29_3415 (ackA)
  09102 Energy metabolism
   00680 Methane metabolism
    BF29_3415 (ackA)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    BF29_3415 (ackA)
Enzymes [BR:bcoa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     BF29_3415 (ackA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: AJH80182
UniProt: A0A0B5X7J0
Position
3307856..3309079
Genome map
AA seq 407 aa AA seqDB search
MKKIMAINAGSSSLKFKVFNMPDESILIEGVFERIGFDAPEVSYKINGFRQKEKPPIHDH
RDAADYLIEILLENRIVDDLNEISAVGHRITHGGSDFSDSAVLDRTVIQKIENLCELAPL
HNPAGLLGIRAFMKRLPKACAVAVFDTAFHQTLAPETYLYPVPLKLYNQYHIRKYGFHGT
NHQYVASEAALLLEKPLKDLKIISCHLGNGSSICAIQGGKSVNTSMGFTPLAGLMMGTRS
GTIDPSILPFIMKKTGHTIDEMMDMFNRESGLLGISEISNDFRDVELAAKAHNEQAELAI
KMFVNRVTECVGGYVALMGGVDAIVFTAGIGEHSASVRQAVVSNLAYLGAKLDFQSNEEN
GPYIHTPDSKVSLLVIPANEELMIARDTWRLSEGQAARLPEKQIVRV
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaataatggccattaatgcaggcagttcttcattaaaatttaaagtcttcaat
atgccggatgaaagtattttaattgaaggggtgtttgaacgaatcggattcgacgcgcct
gaggtttcatataaaatcaacggtttccgccaaaaagaaaaaccgccgatccacgatcac
cgtgacgctgcggattatttgattgaaattcttttagaaaaccgtattgtcgatgattta
aatgaaatttcagctgtcggccaccggatcacacatggcggttctgacttttcggattct
gccgtactggaccgtacagtgattcaaaaaattgaaaatctgtgcgaactggcacctttg
cataatccggctgggttgctcggaatcagggcttttatgaaaaggcttccgaaagcttgt
gccgtagccgtgttcgataccgctttccatcaaacgcttgcacctgaaacgtatttgtat
ccggtgcctttgaaattatacaaccaatatcatatccggaaatacggcttccatggaacc
aatcatcagtatgttgccagtgaagcggccctgcttcttgaaaaaccattgaaagatttg
aaaatcatttcctgccatttagggaacggttccagcatttgcgcaattcaaggcggaaag
tctgtcaatacttcaatgggctttaccccgctggccggattgatgatgggaacgcgttcc
ggtacaatagatccttccatccttccatttatcatgaaaaaaacagggcacaccattgat
gaaatgatggatatgttcaatagagagtccggcttgctcggcatttccgagatttcaaat
gatttccgcgacgtggagctggcagcaaaagcccataatgagcaggcggaattggcaatc
aaaatgtttgtgaatcgtgtgacagaatgtgtcggcggttatgttgcattgatgggcggg
gtggatgccattgtgttcacggcagggatcggggaacattctgcctccgtccggcaagca
gtggtgtccaatttagcctatcttggggcaaaattggatttccagtcaaacgaagaaaac
gggccgtatattcatacccctgattcaaaagtgtctttactggtcattccggcaaacgaa
gaattgatgattgcacgggatacctggcgcttaagtgaagggcaagccgcgcgtttgccc
gaaaaacaaatcgtgagggtctga

DBGET integrated database retrieval system