KEGG   Baudoinia panamericana: BAUCODRAFT_28505Help
Entry
BAUCODRAFT_28505  CDS       T03106                                 

Definition
(RefSeq) hypothetical protein
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
bcom  Baudoinia panamericana
Pathway
bcom00450  Selenocompound metabolism
bcom00970  Aminoacyl-tRNA biosynthesis
bcom01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcom00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BAUCODRAFT_28505
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BAUCODRAFT_28505
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bcom01007]
    BAUCODRAFT_28505
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bcom03016]
    BAUCODRAFT_28505
Enzymes [BR:bcom01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     BAUCODRAFT_28505
Amino acid related enzymes [BR:bcom01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BAUCODRAFT_28505
Transfer RNA biogenesis [BR:bcom03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BAUCODRAFT_28505
 Prokaryotic type
   Other AARSs
    BAUCODRAFT_28505
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e
Motif
Other DBs
NCBI-GeneID: 19110725
NCBI-ProteinID: XP_007681349
JGI: Bauco1_28505
UniProt: M2MYL9
Position
Unknown
AA seq 532 aa AA seqDB search
MILTDVLKRWQVLKGRKSILCTGTDEHGMKIQQAANKAGVPPKEFCDRGADVFRNLANRI
GISSDVFIRTTDTRHKDAVEYAWQMLQDRGYIYESKHEGWYSVSDETFYPPSQVQLVVDP
PTGRKIMVSIETGKEVEWTSERNYHFRLSAFKDQLLAFYEENPQFVIPRTRMGEVVHEVS
TSLSDLSISRPVERLTWGVRVPTDPSQTIYVWLDALLSYASAAGYPFTPGSASSGGWPAD
IHVVGKDIVRFHCIYWPAFLMALGLPLPKQILTHAHWTLGRQKMAKSTGNVVNPFFALDR
FGIDIMRWYLVHEGGITDDADYDNRYIIEKYKKNLQGGLGNLTSRIMRGKGWDVRRAVKQ
YANPAFSEHADQDAKAMCSRIAALPLQVDKHMHDLHPNRALQTLMRAVADMNAYLQHVSP
WTLVTKLQSISTDTTGQELHEAAKAGQSPEQLEAEIDQCIFLAAETLRLVGIMLQPFIPT
SAKRLLDMVGVEAEKRTWEWCEVGKDGSYGLPMVDLGRGEKGVLFPGLTSDF
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgatcttgacggacgttctgaagcggtggcaagttctcaaaggccgcaaatccatccta
tgcacaggtaccgacgaacatggcatgaagatccaacaagcggccaacaaggccggcgtg
ccaccgaaagagttctgtgaccgcggtgccgacgttttcaggaatcttgcaaataggatt
ggcatcagtagcgatgtgtttatccggacgacagacacccggcacaaggatgctgtcgag
tatgcttggcagatgctgcaggatagggggtacatctacgaaagcaagcatgaagggtgg
tatagcgtcagtgacgagacgttctacccaccatcgcaggtacagctggttgtggacccg
ccgactggccgcaagattatggtgagcattgagacggggaaggaggtggagtggacgagt
gagcggaactaccatttccgcctgagcgcattcaaagaccaattacttgctttctacgag
gaaaacccacagtttgtcatccctcgaacacggatgggtgaggtagtccacgaagtcagt
acctccctgtccgacctgtccatctccaggcccgtggaacgtttgacatggggagtccgc
gtgccgacagacccttcacaaaccatctacgtctggcttgacgctctcctcagttatgct
agtgcagctggctaccccttcacaccaggctcagcatcttcaggtggctggccagcagac
attcatgtcgtgggcaaagacatcgtccgcttccactgcatctactggcccgccttcctc
atggccctcggccttcctctccccaagcaaatcctcacccacgcccattggacgctaggc
cgtcagaagatggcgaagagcaccggcaacgtcgtcaaccctttcttcgccctcgaccgt
ttcggcatcgacatcatgcgctggtacctcgtacacgaaggcggcatcaccgacgatgca
gactacgacaatcgctacatcattgagaaatacaagaaaaacctccaaggcggcctgggc
aacctaacgagccgcatcatgcgcggcaagggatgggacgtccggcgagccgtgaaacag
tacgccaacccggcgttctctgaacatgcggaccaagatgccaaagcgatgtgttcccgc
atcgccgccctacctttgcaagtggacaagcacatgcacgacctgcaccccaaccgcgcc
ttacaaaccctcatgcgcgccgtggccgacatgaacgcctatctccagcacgtctccccg
tggacgctcgttacgaaactgcagtccatctccaccgacacgacgggccaagagctccac
gaggcggcgaaggcgggacagtcacctgagcagctggaggcagagatagatcagtgcatt
ttcctcgccgcggaaacgctgcggttggtgggtatcatgctgcagccattcatccctacg
tctgcgaagcggttgctggatatggtgggcgtggaggcggagaagaggacgtgggagtgg
tgcgaggtaggcaaggatggaagttacggtctcccgatggtagatctggggagaggagag
aagggcgtgctcttcccgggcctgacgagtgatttctag

DBGET integrated database retrieval system