KEGG   Baudoinia panamericana: BAUCODRAFT_30005Help
Entry
BAUCODRAFT_30005  CDS       T03106                                 

Definition
(RefSeq) hypothetical protein
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bcom  Baudoinia panamericana
Pathway
bcom00020  Citrate cycle (TCA cycle)
bcom00310  Lysine degradation
bcom00380  Tryptophan metabolism
bcom01100  Metabolic pathways
bcom01110  Biosynthesis of secondary metabolites
bcom01130  Biosynthesis of antibiotics
bcom01200  Carbon metabolism
Module
bcom_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bcom_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bcom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BAUCODRAFT_30005
  09105 Amino acid metabolism
   00310 Lysine degradation
    BAUCODRAFT_30005
   00380 Tryptophan metabolism
    BAUCODRAFT_30005
Enzymes [BR:bcom01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BAUCODRAFT_30005
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 GCV_H RnfC_N PHD_like Nucleo_P87 SOG2
Motif
Other DBs
NCBI-GeneID: 19111084
NCBI-ProteinID: XP_007672920
JGI: Bauco1_30005
UniProt: M2NKI3
Position
Unknown
AA seq 480 aa AA seqDB search
MSSSQLLRRLAAGARPILRQLPQGSRSSLRCLSSQPIRLVPALQRRQIPALISQSRPFSL
SSHRHEEQIVKVPDMAESITEGTLKQFSKQPGDYVEQDEEIATIETDKIDVAVNAPTAGT
IKEFLAKEEDTVTVGQDLVRLELGGEPGQKAEKGKEEPKSPASGAQETSSQPDGQKEESK
PEPKQESKPESPKQESKPEPPKQESKPQPPKQESKPEPPKQKEESKQPQKLPSEQSPKVE
SPYGSREERRVKMNRMRLRIAERLKQSQNTAASLTTFNEVDMSALMDMRKRYKDEILKNT
GVKLGFMSAFSKAAVLAMKDIPAVNASIEGAGSGDTIVYRDYVDISVAVATEKGLVTPVV
RNAESLDMVGIEKAIAELGKKARDNKLTIEDMAGGTFTISNGGVFGSLMGTPIINLPQTA
VLGLHAIKDKPVAIAGKVEIRPMMYLALTYDHRLLDGREAVTFLVKIKEYIEDPRKMLLV
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagctcacaactcctacgtcggctcgccgctggcgcaagacccatcctacgccag
ctcccgcagggctccagaagctctctacgatgcctaagctcacagcctatacgtctcgta
cctgccttacaacggcgacaaatacctgcgcttatctcccagtcccgccctttcagcttg
tcaagtcatcgccatgaagagcaaattgtcaaggtgccagatatggcagagtcgatcacg
gagggtaccctgaaacagttttccaaacagcctggcgactacgtagagcaggatgaggaa
atcgctacgatcgagaccgacaagatcgatgtggctgtcaacgcgcctactgctggcaca
atcaaggaatttctggccaaggaggaagacaccgtgaccgttggacaggacctcgtgcgg
ttagagcttggcggtgagccagggcagaaggcagagaagggcaaggaagaacccaaatcg
ccggcatcaggcgctcaggagacgtcttcgcagcccgacggccagaaggaggagtcaaag
ccagagccgaagcaagaatctaagcccgaatcaccgaagcaggaatccaagcccgaacca
ccgaagcaggaatccaagcctcaaccgccaaagcaagaatcgaaaccggagccgccaaag
cagaaagaagagtctaaacagcctcagaagctgccttccgaacagtcgccaaaggtcgaa
tcaccgtatggcagccgcgaagaacgccgggtgaagatgaaccgtatgcgtttgcgcatt
gccgagcgtctcaagcagtcgcagaacaccgctgcctcactaacaaccttcaacgaggtc
gacatgtctgcgctcatggacatgcggaagcggtacaaggatgagatccttaagaacact
ggcgtgaagcttggcttcatgagcgcattctccaaggcggccgtgcttgcgatgaaggac
attcccgctgtcaatgccagtatagagggcgctggtagtggtgacacgatcgtgtaccgt
gactacgttgacatcagtgttgcggtggcgacggagaagggtctggttacccctgtggtg
cgtaatgcggaaagcctggacatggttggcattgagaaggcgattgcggaactcggcaag
aaggcgcgcgataacaagctcacgatcgaagacatggctggcggcaccttcaccatcagc
aacgggggcgtctttggctcgctgatgggcacacccattatcaaccttccgcagaccgcc
gtacttggcctgcacgccatcaaggacaagccggtcgccatcgctggcaaggttgaaatc
aggccgatgatgtatctcgctcttacatacgaccacagactactggacggccgcgaagca
gtgactttcctagtcaagatcaaggagtatatcgaagacccgcggaagatgcttcttgta
tga

DBGET integrated database retrieval system